CACNG1 antibody - N-terminal region (ARP37668_P050) | Aviva Systems Biology ARP37668 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

CACNG1 antibody - N-terminal region (ARP37668_P050)

catalog :

ARP37668

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP37668

product type :

Polyclonal Antibody

category :

Polyclonal

name :

CACNG1 antibody - N-terminal region (ARP37668_P050)

size :

100 ul

gene symbol :

CACNG1

alias symbols :

CACNLG

nucleotide accession num :

NM_000727

protein accession num :

NP_000718

swissprot id :

Q06432

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

SKTCGPITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYS
ISAAAIAIFSL
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

L-type calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of several gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is a member of the neuronal calcium channel gamma subunit gene subfamily of the PMP-22/EMP/MP2 family and is located in a cluster with two similar gamma subunit-encoding genes.

host :

Rabbit

application :

homology :

Cow: 93%; Dog: 86%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human CACNG1

drywet surcharge :

Wet Ice

storage temperature :

-20C