GJD2 antibody - middle region (ARP36623_P050) | Aviva Systems Biology ARP36623 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

GJD2 antibody - middle region (ARP36623_P050)

catalog :

ARP36623

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot, immunohistochemistry

product information

sku :

ARP36623

product type :

Polyclonal Antibody

category :

Polyclonal

name :

GJD2 antibody - middle region (ARP36623_P050)

size :

100 ul

gene symbol :

GJD2

alias symbols :

CX36, GJA9, MGC138315, MGC138319

nucleotide accession num :

NM_020660

protein accession num :

NP_065711

swissprot id :

Q9UKL4

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

ELNHLGWRKIKLAVRGAQAKRKSIYEIRNKDLPRVSVPN
FGRTQSSDSAY
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

GJD2 is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.This gene is a member of the connexin gene family that is expressed predominantly in mammalian neurons. Connexins associate in groups of 6 and are organized radially around a central pore to form connexons. Each gap junction intercellular channel is formed by the conjunction of 2 connexons.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human GJD2

drywet surcharge :

Wet Ice

storage temperature :

-20C