ZP3 antibody - C-terminal region (ARP35855_T100) | Aviva Systems Biology ARP35855 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

ZP3 antibody - C-terminal region (ARP35855_T100)

catalog :

ARP35855

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat, bovine

application :

western blot

product information

sku :

ARP35855

product type :

Polyclonal Antibody

category :

Polyclonal

name :

ZP3 antibody - C-terminal region (ARP35855_T100)

size :

100 ul

gene symbol :

ZP3

alias symbols :

ZPC, ZP3A, ZP3B, Zp-3

swissprot id :

P21754-2

species reactivity :

Cow, Horse, Human, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

NKGDCGTPSHSRRQPHVMSQWSRSASRNRRHVTEEADVT
VGATDLPGQEW
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The protein encoded by this gene is a structural component of the zona pellucida and functions in primary binding and induction of the sperm acrosome reaction. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a C-terminal consensus furin cleavage site, and a transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. A variation in the last exon of this gene has previously served as the basis for an additional ZP3 locus; however, sequence and literature review reveals that there is only one full-length ZP3 locus in the human genome. Another locus encoding a bipartite transcript designated POMZP3 contains a duplication of the last four exons of ZP3, including the above described variation, and maps closely to this gene

host :

Rabbit

application :

homology :

Cow: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 90%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human ZP3

drywet surcharge :

Wet Ice

storage temperature :

-20C