ILF2 antibody - C-terminal region (ARP35731_T100) | Aviva Systems Biology ARP35731 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

ILF2 antibody - C-terminal region (ARP35731_T100)

catalog :

ARP35731

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, dogs, bovine, zebrafish

application :

western blot, immunohistochemistry

product information

sku :

ARP35731

product type :

Polyclonal Antibody

category :

Polyclonal

name :

ILF2 antibody - C-terminal region (ARP35731_T100)

size :

100 ul

gene symbol :

ILF2

alias symbols :

NF45, PRO3063

nucleotide accession num :

NM_004515

protein accession num :

NP_004506

swissprot id :

Q12905

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

HGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKP
PEKKEGEEEEE
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Nuclear factor of activated T-cells (NFAT) is a transcription factor required for T-cell expression of the interleukin 2 gene. NFAT binds to a sequence in the interleukin 2 gene enhancer known as the antigen receptor response element 2. In addition, NFAT can bind RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. NFAT is a heterodimer of 45 kDa and 9 kDa proteins, the smaller of which is the product of the ILF2 gene. The encoded protein binds strongly to the 9 kDa protein and stimulates its ability to enhance gene expression.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human ILF2

drywet surcharge :

Wet Ice

storage temperature :

-20C