This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
KCNN2 antibody - middle region (ARP35439_P050)
catalog :
ARP35439
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, dogs, zebrafish
application :
western blot, immunohistochemistry
product information
sku :
ARP35439
product type :
Polyclonal Antibody
category :
Polyclonal
name :
KCNN2 antibody - middle region (ARP35439_P050)
size :
100 ul
gene symbol :
KCNN2
alias symbols :
KCa2.2, SK2, SKCA2, hSK2
nucleotide accession num :
NM_170775
protein accession num :
NP_740721
swissprot id :
Q6PJI0
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQA
IHQLRSVKMEQ
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
KCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP.Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by this gene is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This gene is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for this gene.
host :
Rabbit
application :
IHC, WB
homology :
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human KCNN2
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com
1-858-552-6979
headquarters: United States