KCNK4 antibody - N-terminal region (ARP35380_P050) | Aviva Systems Biology ARP35380 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

KCNK4 antibody - N-terminal region (ARP35380_P050)

catalog :

ARP35380

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat, dogs, bovine

application :

western blot

product information

sku :

ARP35380

product type :

Polyclonal Antibody

category :

Polyclonal

name :

KCNK4 antibody - N-terminal region (ARP35380_P050)

size :

100 ul

gene symbol :

KCNK4

alias symbols :

K2p4.1, TRAAK, TRAAK1

nucleotide accession num :

NM_033310

protein accession num :

NP_201567

swissprot id :

Q9NYG8

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQREL
GEVREKFLRAH
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. KCNK4 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. It homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids. Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. This gene encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. The encoded protein homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Pig: 100%; Rat: 79%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human KCNK4

drywet surcharge :

Wet Ice

storage temperature :

-20C