TRPC6 antibody - middle region (ARP35144_P050) | Aviva Systems Biology ARP35144 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

TRPC6 antibody - middle region (ARP35144_P050)

catalog :

ARP35144

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP35144

product type :

Polyclonal Antibody

category :

Polyclonal

name :

TRPC6 antibody - middle region (ARP35144_P050)

size :

100 ul

gene symbol :

TRPC6

alias symbols :

FLJ11098, FLJ14863, FSGS2, TRP6

nucleotide accession num :

NM_004621

protein accession num :

NP_004612

swissprot id :

Q9Y210

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

KKGFQEDAEMNKINEEKKLGILGSHEDLSKLSLDKKQVG
HNKQPSIRSSE
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

TRPC6 forms a receptor-activated calcium channel in the cell membrane. The channel is activated by diacylglycerol and is thought to be under the control of a phosphatidylinositol second messenger system. Activation of this channel occurs independently of protein kinase C and is not triggered by low levels of intracellular calcium. Defects in this gene are a cause of focal segmental glomerulosclerosis 2 (FSGS2).

host :

Rabbit

application :

homology :

Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 85%; Pig: 100%; Rat: 77%; Yeast: 86%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human TRPC6

drywet surcharge :

Wet Ice

storage temperature :

-20C