This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
VDAC2 antibody - N-terminal region (ARP35123_P050)
catalog :
ARP35123
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine, zebrafish
application :
western blot, immunohistochemistry
citations: 1
product information
sku :
ARP35123
product type :
Polyclonal Antibody
category :
Polyclonal
name :
VDAC2 antibody - N-terminal region (ARP35123_P050)
size :
100 ul
gene symbol :
VDAC2
alias symbols :
RP11-375G3.1, FLJ23841, POR
nucleotide accession num :
NM_003375
protein accession num :
NP_003366
swissprot id :
P45880-5
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVK
LDVKTKSCSGV
Synthetic peptide located within the following region:
LDVKTKSCSGV
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 3-4 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.
host :
Rabbit
application :
IHC, WB
homology :
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 79%; Zebrafish: 86%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the N terminal region of human VDAC2
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
