KCNN2 antibody - C-terminal region (ARP35094_T100) | Aviva Systems Biology ARP35094 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

KCNN2 antibody - C-terminal region (ARP35094_T100)

catalog :

ARP35094

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, dogs, zebrafish

application :

western blot, immunohistochemistry

product information

sku :

ARP35094

product type :

Polyclonal Antibody

category :

Polyclonal

name :

KCNN2 antibody - C-terminal region (ARP35094_T100)

size :

100 ul

gene symbol :

KCNN2

alias symbols :

SK2, hSK2, SKCA2, KCa2.2

nucleotide accession num :

NM_021614

protein accession num :

NP_067627

swissprot id :

Q9H2S1

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish, Monkey

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVD
LAKTQNIMYDM
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Action potentials in vertebrate neurons are followed by an afterhyperpolarization (AHP) that may persist for several seconds and may have profound consequences for the firing pattern of the neuron. Each component of the AHP is kinetically distinct and is mediated by different calcium-activated potassium channels. The protein encoded by KCNN2 is activated before membrane hyperpolarization and is thought to regulate neuronal excitability by contributing to the slow component of synaptic AHP. The encoded protein is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. KCNN2 is a member of the KCNN family of potassium channel genes.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Yeast: 100%; Zebrafish: 93%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human KCNN2

drywet surcharge :

Wet Ice

storage temperature :

-20C