GABRR2 antibody - middle region (ARP35060_P050) | Aviva Systems Biology ARP35060 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

GABRR2 antibody - middle region (ARP35060_P050)

catalog :

ARP35060

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot, immunohistochemistry

product information

sku :

ARP35060

product type :

Polyclonal Antibody

category :

Polyclonal

name :

GABRR2 antibody - middle region (ARP35060_P050)

size :

100 ul

gene symbol :

GABRR2

alias symbols :

nucleotide accession num :

NM_002043

protein accession num :

NP_002034

swissprot id :

P28476

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIM
LRVFPDGHVLY
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR2 is a member of the rho subunit family and is a component of the GABA receptor complex.GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. The protein encoded by this gene is a member of the rho subunit family and is a component of the GABA receptor complex. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3 BX49975.1 6-89 31-1586 BC13352.1 1-1556 1587-1631 M86868.1 1584-1628

host :

Rabbit

application :

WB, IHC

homology :

Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human GABRR2

drywet surcharge :

Wet Ice

storage temperature :

-20C