THRA antibody - middle region (ARP34780_P050) | Aviva Systems Biology ARP34780 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

THRA antibody - middle region (ARP34780_P050)

catalog :

ARP34780

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP34780

product type :

Polyclonal Antibody

category :

Polyclonal

name :

THRA antibody - middle region (ARP34780_P050)

size :

100 ul

gene symbol :

THRA

alias symbols :

AR7, EAR7, ERB-T-1, ERBA, ERBA1, MGC000261, MGC43240, NR1A1, THRA1, THRA2, c-ERBA-1, CHNG6

nucleotide accession num :

NM_003250

protein accession num :

NP_003241

swissprot id :

P10827

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

DQIILLKGCCMEIMSLRAAVRYDPESDTLTLSGEMAVKR
EQLKNGGLGVV
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

The THRA gene encodes a protein that is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human THRA

drywet surcharge :

Wet Ice

storage temperature :

-20C