This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
DMTF1 Antibody - C-terminal region (ARP34602_P050)
catalog :
ARP34602
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, dogs
application :
western blot, immunohistochemistry
product information
sku :
ARP34602
product type :
Polyclonal Antibody
category :
Polyclonal
name :
DMTF1 Antibody - C-terminal region (ARP34602_P050)
size :
100 ul
gene symbol :
DMTF1
alias symbols :
DMP1, DMTF, MRUL, hDMP1
nucleotide accession num :
NM_001142326
protein accession num :
EAW76962
swissprot id :
Q9Y222
species reactivity :
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEE
SPSDLASAYVT
Synthetic peptide located within the following region:
SPSDLASAYVT
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 4% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
host :
Rabbit
application :
IHC, WB
homology :
Dog: 92%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the C terminal region of human DMTF1
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
