ZYX antibody - middle region (ARP34387_T100) | Aviva Systems Biology ARP34387 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

ZYX antibody - middle region (ARP34387_T100)

catalog :

ARP34387

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP34387

product type :

Polyclonal Antibody

category :

Polyclonal

name :

ZYX antibody - middle region (ARP34387_T100)

size :

100 ul

gene symbol :

ZYX

alias symbols :

ESP-2, HED-2

nucleotide accession num :

NM_003461

protein accession num :

NP_003452

swissprot id :

Q15942

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

GSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSP
GAPGPLTLKEV
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles.

host :

Rabbit

application :

homology :

Cow: 85%; Dog: 92%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 91%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human ZYX

drywet surcharge :

Wet Ice

storage temperature :

-20C