CCK antibody - middle region (ARP33849_P050) | Aviva Systems Biology ARP33849 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

CCK antibody - middle region (ARP33849_P050)

catalog :

ARP33849

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP33849

product type :

Polyclonal Antibody

category :

Polyclonal

name :

CCK antibody - middle region (ARP33849_P050)

size :

100 ul

gene symbol :

CCK

alias symbols :

MGC117187

nucleotide accession num :

NM_000729

protein accession num :

NP_000720

swissprot id :

P06307

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFG
RRSAEEYEYPS
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

homology :

Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Rat: 92%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human CCK

drywet surcharge :

Wet Ice

storage temperature :

-20C