TIPARP antibody - N-terminal region (ARP33763_P050) | Aviva Systems Biology ARP33763 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

TIPARP antibody - N-terminal region (ARP33763_P050)

catalog :

ARP33763

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP33763

product type :

Polyclonal Antibody

category :

Polyclonal

name :

TIPARP antibody - N-terminal region (ARP33763_P050)

size :

100 ul

gene symbol :

TIPARP

alias symbols :

DDF1, DKFZP434J214, DKFZp686N0351, DKFZp686P1838, FLJ40466, PARP-1, PARP-7, PARP7, pART14

nucleotide accession num :

NM_015508

protein accession num :

NP_056323

swissprot id :

Q7Z3E1

species reactivity :

Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

LKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLDGVFR
SRNQSTDENSL
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

TIPARP is a poly [ADP-ribose] polymerase using NAD+ as a substrate to transfer ADP-ribose onto glutamic acid residues of a protein acceptor; repeated rounds of ADP-ribosylation leads to the formation of poly(ADPribose) chains on the protein, thereby altering the function of the target protein. TIPARP may play a role in the adaptative response to chemical exposure (TCDD) and thereby mediates certain effects of the chemicals.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 83%; Pig: 100%; Rabbit: 92%; Rat: 83%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human TIPARP

drywet surcharge :

Wet Ice

storage temperature :

-20C