PARP16 antibody - middle region (ARP33752_P050) | Aviva Systems Biology ARP33752 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

PARP16 antibody - middle region (ARP33752_P050)

catalog :

ARP33752

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP33752

product type :

Polyclonal Antibody

category :

Polyclonal

name :

PARP16 antibody - middle region (ARP33752_P050)

size :

100 ul

gene symbol :

PARP16

alias symbols :

C15orf30, FLJ20509, FLJ25281, pART15

nucleotide accession num :

NM_017851

protein accession num :

NP_060321

swissprot id :

Q8N5Y8-3

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSH
WFTVMISLYLL
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks. A large repertoire of sequences encoding novel PARPs now extends considerably the field of poly(ADP-ribosyl)ation reactions to various aspects of the cell biology including cell proliferation and cell death. Some of these new members interact with each other, share common partners and common subcellular localizations suggesting possible fine tuning in the regulation of this post-translational modification of proteins.

host :

Rabbit

application :

WB, IHC

homology :

Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 80%; Rabbit: 86%; Rat: 86%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human PARP16

drywet surcharge :

Wet Ice

storage temperature :

-20C