This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
PARP16 antibody - middle region (ARP33752_P050)
catalog :
ARP33752
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot, immunohistochemistry
product information
sku :
ARP33752
product type :
Polyclonal Antibody
category :
Polyclonal
name :
PARP16 antibody - middle region (ARP33752_P050)
size :
100 ul
gene symbol :
PARP16
alias symbols :
C15orf30, FLJ20509, FLJ25281, pART15
nucleotide accession num :
NM_017851
protein accession num :
NP_060321
swissprot id :
Q8N5Y8-3
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSH
WFTVMISLYLL
Synthetic peptide located within the following region:
WFTVMISLYLL
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks. A large repertoire of sequences encoding novel PARPs now extends considerably the field of poly(ADP-ribosyl)ation reactions to various aspects of the cell biology including cell proliferation and cell death. Some of these new members interact with each other, share common partners and common subcellular localizations suggesting possible fine tuning in the regulation of this post-translational modification of proteins.
host :
Rabbit
application :
WB, IHC
homology :
Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 80%; Rabbit: 86%; Rat: 86%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human PARP16
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
