CLDN5 antibody - C-terminal region (ARP33627_P050) | Aviva Systems Biology ARP33627 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

CLDN5 antibody - C-terminal region (ARP33627_P050)

catalog :

ARP33627

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, bovine

application :

western blot

product information

sku :

ARP33627

product type :

Polyclonal Antibody

category :

Polyclonal

name :

CLDN5 antibody - C-terminal region (ARP33627_P050)

size :

100 ul

gene symbol :

CLDN5

alias symbols :

AWAL, BEC1, CPETRL1, TMVCF

nucleotide accession num :

NM_003277

protein accession num :

NP_003268

swissprot id :

O00501

species reactivity :

Cow, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRR
PTATGDYDKKN
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

homology :

Cow: 93%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human CLDN5

drywet surcharge :

Wet Ice

storage temperature :

-20C