STAT1 antibody - N-terminal region (ARP33373_P050) | Aviva Systems Biology ARP33373 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

STAT1 antibody - N-terminal region (ARP33373_P050)

catalog :

ARP33373

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP33373

product type :

Polyclonal Antibody

category :

Polyclonal

name :

STAT1 antibody - N-terminal region (ARP33373_P050)

size :

100 ul

gene symbol :

STAT1

alias symbols :

DKFZp686B04100, ISGF-3, STAT91, CANDF7

nucleotide accession num :

NM_007315

protein accession num :

NP_009330

swissprot id :

P42224

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

MCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQ
KQEQLLLKKMY
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

STAT1 is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens.The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described.

host :

Rabbit

application :

homology :

Cow: 92%; Dog: 84%; Guinea Pig: 92%; Horse: 84%; Human: 100%; Mouse: 90%; Pig: 84%; Rabbit: 92%; Rat: 84%; Sheep: 92%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human STAT1

drywet surcharge :

Wet Ice

storage temperature :

-20C