SOX5 antibody - C-terminal region (ARP33323_P050) | Aviva Systems Biology ARP33323 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

SOX5 antibody - C-terminal region (ARP33323_P050)

catalog :

ARP33323

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP33323

product type :

Polyclonal Antibody

category :

Polyclonal

name :

SOX5 antibody - C-terminal region (ARP33323_P050)

size :

100 ul

gene symbol :

SOX5

alias symbols :

L-SOX5, MGC35153

nucleotide accession num :

NM_178010

protein accession num :

NP_821078

swissprot id :

P35711

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

PEPGMPVIQSTYGVKGEEPHIKEEIQAEDINGEIYDEYD
EEEDDPDVDYG
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

SOX5 encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. The encoded protein may play a role in chondrogenesis. A pseudogene of this gene is located on chromosome 8.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

specificity :

Designed to recognize all five isoforms of human SOX5 (84, 82, 42, 71 and 83kDa)

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human SOX5

drywet surcharge :

Wet Ice

storage temperature :

-20C