HSPA1A antibody - middle region (ARP33096_T100) | Aviva Systems Biology ARP33096 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

HSPA1A antibody - middle region (ARP33096_T100)

catalog :

ARP33096

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, bovine

application :

western blot

product information

sku :

ARP33096

product type :

Polyclonal Antibody

category :

Polyclonal

name :

HSPA1A antibody - middle region (ARP33096_T100)

size :

100 ul

gene symbol :

HSPA1A

alias symbols :

HSP72, HSPA1, HSP70I, HSPA1B, HSP70-1, HSP70-1A

nucleotide accession num :

NM_005345

protein accession num :

CAI18465

swissprot id :

P08107

species reactivity :

Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDA
KLDKAQIHDLV
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

HSPA1A is a member of the heat shock protein 7 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human HSPA1A

drywet surcharge :

Wet Ice

storage temperature :

-20C