This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
HSPA1A antibody - middle region (ARP33096_T100)
catalog :
ARP33096
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, bovine
application :
western blot
product information
sku :
ARP33096
product type :
Polyclonal Antibody
category :
Polyclonal
name :
HSPA1A antibody - middle region (ARP33096_T100)
size :
100 ul
gene symbol :
HSPA1A
alias symbols :
HSP72, HSPA1, HSP70I, HSPA1B, HSP70-1, HSP70-1A
nucleotide accession num :
NM_005345
protein accession num :
CAI18465
swissprot id :
P08107
species reactivity :
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
SLFEGIDFYTSITRARFEELCSDLFRSTLEPVEKALRDA
KLDKAQIHDLV
Synthetic peptide located within the following region:
KLDKAQIHDLV
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
HSPA1A is a member of the heat shock protein 7 family. In conjuction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. It is also involved in the ubiquitin-proteasome pathway through interaction with the AU-rich element RNA-binding protein 1.
host :
Rabbit
application :
WB
homology :
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%
purification :
Protein A purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human HSPA1A
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
