SLC38A2 antibody - N-terminal region (ARP33059_P050) | Aviva Systems Biology ARP33059 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

SLC38A2 antibody - N-terminal region (ARP33059_P050)

catalog :

ARP33059

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP33059

product type :

Polyclonal Antibody

category :

Polyclonal

name :

SLC38A2 antibody - N-terminal region (ARP33059_P050)

size :

100 ul

gene symbol :

SLC38A2

alias symbols :

ATA2, KIAA1382, PRO1068, SAT2, SNAT2

nucleotide accession num :

NM_018976

protein accession num :

NP_061849

swissprot id :

Q96QD8

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

AALKSHYADVDPENQNFLLESNLGKKKYETEFHPGTTSF
GMSVFNLSNAI
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Under hypertonic conditions the induction of SLC38A2/SNAT2 leads to the stimulation of transport system A and to the increase in the cell content of amino acids. Its amino acid response element, along with a nearby conserved CAAT box, has enhancer activity in that it functions in an orientation and position independent manner, and it confers regulated transcription to a heterologous promoter.

host :

Rabbit

application :

homology :

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC38A2

drywet surcharge :

Wet Ice

storage temperature :

-20C