JMJD2C antibody - C-terminal region (ARP32974_P050) | Aviva Systems Biology ARP32974 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

JMJD2C antibody - C-terminal region (ARP32974_P050)

catalog :

ARP32974

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP32974

product type :

Polyclonal Antibody

category :

Polyclonal

name :

JMJD2C antibody - C-terminal region (ARP32974_P050)

size :

100 ul

gene symbol :

KDM4C

alias symbols :

FLJ25949, GASC1, JHDM3C, JMJD2C, KIAA0780, bA146B14.1

nucleotide accession num :

NM_001146695

protein accession num :

NP_001140167

swissprot id :

F5H347

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

CLCNLRGGALKQTKNNKWAHVMCAVAVPEVRFTNVPERT
QIDVGRIPLQR
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

JMJD2C is a member of the Jumonji domain 2 (JMJD2) family. It contains one JmjC domain, one JmjN domain, two PHD-type zinc fingers, and two Tudor domains. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form. Chromosomal aberrations and increased transcriptional expression of this gene are associated with esophageal squamous cell carcinoma.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human JMJD2C

drywet surcharge :

Wet Ice

storage temperature :

-20C