This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
DLX1 antibody - C-terminal region (ARP32866_P050)
catalog :
ARP32866
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot
product information
sku :
ARP32866
product type :
Polyclonal Antibody
category :
Polyclonal
name :
DLX1 antibody - C-terminal region (ARP32866_P050)
size :
100 ul
gene symbol :
DLX1
alias symbols :
-
nucleotide accession num :
NM_178120
protein accession num :
NP_835221
swissprot id :
P56177
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
KFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNS
SSGKGSGGNAG
Synthetic peptide located within the following region:
SSGKGSGGNAG
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
DLX1 is a member of a homeobox transcription factor family. It is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. DLX1 may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain.This gene encodes a member of a homeobox transcription factor gene family similiar to the Drosophila distal-less gene. The encoded protein is localized to the nucleus where it may function as a transcriptional regulator of signals from multiple TGF-{beta} superfamily members. The encoded protein may play a role in the control of craniofacial patterning and the differentiation and survival of inhibitory neurons in the forebrain. This gene is located in a tail-to-tail configuration with another member of the family on the long arm of chromosome 2. Alternatively spliced transcript variants encoding different isoforms have been described.
host :
Rabbit
application :
WB
homology :
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the C terminal region of human DLX1
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments