This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
CITED1 antibody - middle region (ARP32705_P050)
catalog :
ARP32705
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot, immunohistochemistry
product information
sku :
ARP32705
product type :
Polyclonal Antibody
category :
Polyclonal
name :
CITED1 antibody - middle region (ARP32705_P050)
size :
100 ul
gene symbol :
CITED1
alias symbols :
MSG1
nucleotide accession num :
NM_004143
protein accession num :
NP_004134
swissprot id :
Q99966
species reactivity :
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
IGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGM
AAATPGQPGEA
Synthetic peptide located within the following region:
AAATPGQPGEA
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
CBP/p3-interacting transactivator 1 (CITED1, melanocyte-specific protein 1 ) is a nuclear protein that shares two highly conserved domains, CR1 and CR2. The CR2 domain is significantly acidic and activates transcription in yeast cells.
host :
Rabbit
application :
IHC, WB
homology :
Cow: 85%; Dog: 85%; Guinea Pig: 85%; Human: 100%; Mouse: 77%; Rabbit: 83%; Rat: 85%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human CITED1
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com1-858-552-6979
headquarters: United States
questions and comments
