TBX21 antibody - middle region (ARP32612_P050) | Aviva Systems Biology ARP32612 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

TBX21 antibody - middle region (ARP32612_P050)

catalog :

ARP32612

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP32612

product type :

Polyclonal Antibody

category :

Polyclonal

name :

TBX21 antibody - middle region (ARP32612_P050)

size :

100 ul

gene symbol :

TBX21

alias symbols :

HGNC:11599, T-PET, T-bet, TBLYM, TBET

nucleotide accession num :

NM_013351

protein accession num :

NP_037483

swissprot id :

Q9UL17

species reactivity :

Cow, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

SIPSPPGPNCQFLGGDHYSPLLPNQYPVPSRFYPDLPGQ
AKDVVPQAYWL
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

TBX21 is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. It is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 86%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 86%; Rat: 86%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human TBX21

drywet surcharge :

Wet Ice

storage temperature :

-20C