LASS2 antibody - N-terminal region (ARP32609_P050) | Aviva Systems Biology ARP32609 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

LASS2 antibody - N-terminal region (ARP32609_P050)

catalog :

ARP32609

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP32609

product type :

Polyclonal Antibody

category :

Polyclonal

name :

LASS2 antibody - N-terminal region (ARP32609_P050)

size :

100 ul

gene symbol :

CERS2

alias symbols :

CerS2, FLJ10243, L3, MGC987, SP260, TMSG1, LASS2

nucleotide accession num :

NM_022075

protein accession num :

NP_071358

swissprot id :

Q96G23

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

EKTRLRAPPNATLEHFYLTSGKQPKQVEVELLSRQSGLS
GRQVERWFRRR
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

LASS2 is a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. This gene encodes a protein that has sequence similarity to yeast longevity assurance gene 1. Mutation or overexpression of the related gene in yeast has been shown to alter yeast lifespan. The human protein may play a role in the regulation of cell growth. Alternatively spliced transcript variants encoding the same protein have been described.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 86%; Dog: 93%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human LASS2

drywet surcharge :

Wet Ice

storage temperature :

-20C