NPAS4 antibody - middle region (ARP32556_P050) | Aviva Systems Biology ARP32556 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

NPAS4 antibody - middle region (ARP32556_P050)

catalog :

ARP32556

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP32556

product type :

Polyclonal Antibody

category :

Polyclonal

name :

NPAS4 antibody - middle region (ARP32556_P050)

size :

100 ul

gene symbol :

NPAS4

alias symbols :

Le-PAS, NXF, PASD10, bHLHe79

nucleotide accession num :

NM_178864

protein accession num :

NP_849195

swissprot id :

Q8IUM7

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

QAHLDSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPS
PSSPGNGDCTL
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

NXF is a member of the basic helix-loop-helix-PER (MIM 6226)-ARNT (MIM 12611)-SIM (see SIM2; MIM 6892) (bHLH-PAS) class of transcriptional regulators, which are involved in a wide range of physiologic and developmental events.NXF is a member of the basic helix-loop-helix-PER (MIM 6226)-ARNT (MIM 12611)-SIM (see SIM2; MIM 6892) (bHLH-PAS) class of transcriptional regulators, which are involved in a wide range of physiologic and developmental events (Ooe et al., 24 [PubMed 1471734]).[supplied by OMIM].

host :

Rabbit

application :

homology :

Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 86%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human NPAS4

drywet surcharge :

Wet Ice

storage temperature :

-20C