This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Aviva Systems Biology
product type :
antibody
product name :
REST antibody - middle region (ARP32478_P050)
catalog :
ARP32478
quantity :
100 ul
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat, dogs, bovine
application :
western blot
product information
sku :
ARP32478
product type :
Polyclonal Antibody
category :
Polyclonal
name :
REST antibody - middle region (ARP32478_P050)
size :
100 ul
gene symbol :
REST
alias symbols :
NRSF, XBR
nucleotide accession num :
NM_005612
protein accession num :
NP_005603
swissprot id :
Q13127
species reactivity :
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
product format :
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
peptide sequence :
PMLPPSAVEEREAVSKTALASPPATMAANESQEIDEDEG
IHSHEGSDLSD
Synthetic peptide located within the following region:
reconstitution and storage :
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
description of target :
REST is a transcriptional repressor which represses neuronal genes in non-neuronal tissues. It is a member of the Kruppel-type zinc finger transcription factor family. It represses transcription by binding a DNA sequence element called the neuron-restrictive silencer element. The protein is also found in undifferentiated neuronal progenitor cells, and it is thought that this repressor may act as a master negative regular of neurogenesis.This gene encodes a transcriptional repressor which represses neuronal genes in non-neuronal tissues. It is a member of the Kruppel-type zinc finger transcription factor family. It represses transcription by binding a DNA sequence element called the neuron-restrictive silencer element. The protein is also found in undifferentiated neuronal progenitor cells, and it is thought that this repressor may act as a master negative regular of neurogenesis. Alternatively spliced transcript variants have been described; however, their full length nature has not been determined. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
host :
Rabbit
application :
WB
homology :
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
purification :
Affinity Purified
clonality :
Polyclonal
immunogen :
The immunogen is a synthetic peptide directed towards the middle region of human REST
drywet surcharge :
Wet Ice
storage temperature :
-20C
company information
Aviva Systems Biology
7700 Ronson Road, Ste 100, San Diego, CA 92111
info@avivasysbio.com
http://www.avivasysbio.com
1-858-552-6979
headquarters: United States