POLR2B antibody - middle region (ARP32456_P050) | Aviva Systems Biology ARP32456 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

POLR2B antibody - middle region (ARP32456_P050)

catalog :

ARP32456

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot

product information

sku :

ARP32456

product type :

Polyclonal Antibody

category :

Polyclonal

name :

POLR2B antibody - middle region (ARP32456_P050)

size :

100 ul

gene symbol :

POLR2B

alias symbols :

RPB2, POL2RB, hsRPB2, hRPB140

nucleotide accession num :

NM_000938

protein accession num :

NP_000929

swissprot id :

P30876

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

FFRSVFYRSYKEQESKKGFDQEEVFEKPTRETCQGMRHA
IYDKLDDDGLI
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

POLR2B encodes the second largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit, in combination with at least two other polymerase subunits, forms a structure within the polymerase that maintains contact in the active site of the enzyme between the DNA template and the newly synthesized RNA.

host :

Rabbit

application :

homology :

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human POLR2B

drywet surcharge :

Wet Ice

storage temperature :

-20C