EYA1 antibody - middle region (ARP32434_P050) | Aviva Systems Biology ARP32434 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

EYA1 antibody - middle region (ARP32434_P050)

catalog :

ARP32434

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot, immunohistochemistry

product information

sku :

ARP32434

product type :

Polyclonal Antibody

category :

Polyclonal

name :

EYA1 antibody - middle region (ARP32434_P050)

size :

100 ul

gene symbol :

EYA1

alias symbols :

BOP, BOR, MGC141875

nucleotide accession num :

NM_172060

protein accession num :

NP_742057

swissprot id :

Q99502

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

QDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTPS
TNATYQLQEPP
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

EYA1 is a member of the eyes absent (EYA) family of proteins. EYA1 may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and sporadic cases of congenital cataracts and ocular anterior segment anomalies. A similar protein in mice can act as a transcriptional activator.This gene encodes a member of the eyes absent (EYA) family of proteins. The encoded protein may play a role in the developing kidney, branchial arches, eye, and ear. Mutations of this gene have been associated with branchiootorenal dysplasia syndrome, branchiootic syndrome, and sporadic cases of congenital cataracts and ocular anterior segment anomalies. A similar protein in mice can act as a transcriptional activator. Four transcript variants encoding three distinct isoforms have been identified for this gene.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human EYA1

drywet surcharge :

Wet Ice

storage temperature :

-20C