EGR1 antibody - N-terminal region (ARP32241_P050) | Aviva Systems Biology ARP32241 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

EGR1 antibody - N-terminal region (ARP32241_P050)

catalog :

ARP32241

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP32241

product type :

Polyclonal Antibody

category :

Polyclonal

name :

EGR1 antibody - N-terminal region (ARP32241_P050)

size :

100 ul

gene symbol :

EGR1

alias symbols :

AT225, G0S30, KROX-24, NGFI-A, TIS8, ZIF-268, ZNF225

nucleotide accession num :

NM_001964

protein accession num :

NP_001955

swissprot id :

P18146

species reactivity :

Cow, Horse, Human, Mouse, Pig, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

DNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSG
GGGGGGGGSNS
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR13, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 87%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human EGR1

drywet surcharge :

Wet Ice

storage temperature :

-20C