PAX4 antibody - middle region (ARP32064_P050) | Aviva Systems Biology ARP32064 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

PAX4 antibody - middle region (ARP32064_P050)

catalog :

ARP32064

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot

product information

sku :

ARP32064

product type :

Polyclonal Antibody

category :

Polyclonal

name :

PAX4 antibody - middle region (ARP32064_P050)

size :

100 ul

gene symbol :

PAX4

alias symbols :

KPD, MGC129960, MODY9

nucleotide accession num :

NM_006193

protein accession num :

NP_006184

swissprot id :

O43316

species reactivity :

Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPED
TVRVWFSNRRA
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

PAX4 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The paired box gene 4 is involved in pancreatic islet development and mouse studies have demonstrated a role for this gene in differentiation of insulin-producing .- cells.

host :

Rabbit

application :

homology :

Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%

purification :

Affinity Purified

clonality :

Polyclonal

specificity :

100% homologous to all 3 isoforms (38, 30, 37kDa).

immunogen :

The immunogen is a synthetic peptide directed towards the middle region of human PAX4

drywet surcharge :

Wet Ice

storage temperature :

-20C