RIPK3 antibody - N-terminal region (ARP31513_T100) | Aviva Systems Biology ARP31513 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

RIPK3 antibody - N-terminal region (ARP31513_T100)

catalog :

ARP31513

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine

application :

western blot, immunohistochemistry

product information

sku :

ARP31513

product type :

Polyclonal Antibody

category :

Polyclonal

name :

RIPK3 antibody - N-terminal region (ARP31513_T100)

size :

100 ul

gene symbol :

RIPK3

alias symbols :

RIP3, RIP3 beta, RIP3 gamma

nucleotide accession num :

NM_006871

protein accession num :

NP_006862

swissprot id :

Q9Y572

species reactivity :

Cow, Dog, Horse, Human, Mouse, Pig, Rat

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

GGSQSGTGSGEPGGTLGYLAPELFVNVNRKASTASDVYS
FGILMWAVLAG
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

RIPK3 is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.The product of this gene is a member of the receptor-interacting protein (RIP) family of serine/threonine protein kinases, and contains a C-terminal domain unique from other RIP family members. The encoded protein is predominantly localized to the cytoplasm, and can undergo nucleocytoplasmic shuttling dependent on novel nuclear localization and export signals. It is a component of the tumor necrosis factor (TNF) receptor-I signaling complex, and can induce apoptosis and weakly activate the NF-kappaB transcription factor.

host :

Rabbit

application :

IHC, WB

homology :

Cow: 79%; Dog: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 86%; Rat: 91%

purification :

Protein A purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the N terminal region of human RIPK3

drywet surcharge :

Wet Ice

storage temperature :

-20C