TLR2 antibody - C-terminal region (ARP30551_P050) | Aviva Systems Biology ARP30551 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Aviva Systems Biology

product type :

antibody

product name :

TLR2 antibody - C-terminal region (ARP30551_P050)

catalog :

ARP30551

quantity :

100 ul

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat, dogs, bovine, zebrafish

application :

western blot, immunocytochemistry

product information

sku :

ARP30551

product type :

Polyclonal Antibody

category :

Polyclonal

name :

TLR2 antibody - C-terminal region (ARP30551_P050)

size :

100 ul

gene symbol :

TLR2

alias symbols :

CD282, TIL4

nucleotide accession num :

NM_003264

protein accession num :

NP_003255

swissprot id :

O60603

species reactivity :

Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep, Zebrafish

product format :

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

peptide sequence :

LEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFW
VNLRAAIKS
Synthetic peptide located within the following region:

reconstitution and storage :

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

description of target :

TLR2 is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is expressed most abundantly in peripheral blood leukocytes, and mediates host response to Gram-positive bacteria and yeast via stimulation of NF-kappaB. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

host :

Rabbit

application :

IF, IHC-FFPE, WB

homology :

Cow: 91%; Dog: 85%; Goat: 85%; Guinea Pig: 79%; Horse: 92%; Human: 100%; Mouse: 91%; Rat: 92%; Sheep: 91%; Zebrafish: 100%

purification :

Affinity Purified

clonality :

Polyclonal

immunogen :

The immunogen is a synthetic peptide directed towards the C terminal region of human TLR2

drywet surcharge :

Wet Ice

storage temperature :

-20C