product summary
company name :
Atlas Antibodies
product type :
antibody
product name :
Anti-ITGAX
catalog :
AMAb90915
quantity :
100 µl
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human
application :
western blot, immunohistochemistry
more info or order :
image
image 1 :

Immunohistochemical staining of human tonsil shows strong immunoreactivity in the dendritic cells.
image 2 :

Immunohistochemical staining of human colon shows positivity in a subset of lymphoid cells.
image 3 :

Immunohistochemical staining of human fallopian tube shows moderate immunoreactivity in a subset of lymphoid cells.
product information
product number :
AMAb90915
product name :
Anti-ITGAX
clone number :
CL1831
ensembl gene id :
ENSG00000140678
gene description :
integrin, alpha X (complement component 3 receptor 4 subunit)
alternative names :
CD11C
supportive applications :
IHC, WB
clonality :
Monoclonal
category :
Primary
antigen type :
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
antigen sequence :
QDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPR
SAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQS
SVTLDLALDPGRLSPRATFQETKNRSLSRVRV
SAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQS
SVTLDLALDPGRLSPRATFQETKNRSLSRVRV
epitope specificity :
Binds to an epitope located within the peptide sequence LYIDKRSKNLLGSRD as determined by overlapping synthetic peptides.
host animal :
Mouse
species reactivity :
Human
isotype :
IgG1
purification method :
Protein A purified
buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
unit :
100 µl
uniprot id :
P20702
conjugate :
unconjugated
antigen sequence identity mouse :
61
antigen sequence identity rat :
59
more info or order :
company information
Atlas Antibodies
AlbaNova University Center
SE-106 91 Stockholm
SE-106 91 Stockholm
contact@atlasantibodies.com
www.atlasantibodies.com46 8 54 59 58 50
headquarters: Sweden
review
product type
questions and comments
