product summary
company name :
Atlas Antibodies
product type :
antibody
product name :
Anti-SIX1
catalog :
AMAb90544
quantity :
100 µl
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry
more info or order :
image
image 1 :

Immunofluorescence staining in RH30 cell line with Anti-SIX1 monoclonal antibody, showing spotty nuclear staining in green. Microtubule probes are visualized in red (where available).
image 2 :

Immunohistochemical staining of human striated muscle shows strong nuclear immunoreactivity in the myocytes.
image 3 :

Immunohistochemical staining of human liver shows absence of immunoreactivity.
product information
product number :
AMAb90544
product name :
Anti-SIX1
clone number :
CL0185
ensembl gene id :
ENSG00000126778
gene description :
SIX homeobox 1
alternative names :
DFNA23
supportive applications :
ICC-IF, IHC, WB
clonality :
Monoclonal
category :
Primary
antigen type :
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
antigen sequence :
CFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQV
SNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLE
GGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGHARSSNY
SLPGLTASQPSHGLQTHQHQLQDS
SNWFKNRRQRDRAAEAKERENTENNNSSSNKQNQLSPLE
GGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGHARSSNY
SLPGLTASQPSHGLQTHQHQLQDS
epitope specificity :
Binds to an epitope located within the peptide sequence None as determined by overlapping synthetic peptides.
host animal :
Mouse
species reactivity :
Human
isotype :
IgG1
purification method :
Protein A purified
buffer :
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
storage :
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
unit :
100 µl
uniprot id :
Q15475
conjugate :
unconjugated
antigen sequence identity mouse :
99
antigen sequence identity rat :
99
more info or order :
company information
Atlas Antibodies
AlbaNova University Center
SE-106 91 Stockholm
SE-106 91 Stockholm
contact@atlasantibodies.com
www.atlasantibodies.com46 8 54 59 58 50
headquarters: Sweden
review
product type
browse more products
questions and comments
