Anti-GIRK1 (Kir3.1) Antibody | Alomone Labs apc-005 product information

product summary

company name :

Alomone Labs

product type :

antibody

product name :

Anti-GIRK1 (Kir3.1) Antibody

catalog :

apc-005

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

clone name :

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry, immunocytochemistry, immunoprecipitation

more info or order :

Alomone Labs product webpage

citations: 14

Published Application/Species/Sample/Dilution	Reference
immunohistochemistry; rat; 1:1000; fig s1	Zhang L, Hernandez V, Vázquez Juárez E, Chay F, Barrio R. Thirst Is Associated with Suppression of Habenula Output and Active Stress Coping: Is there a Role for a Non-canonical Vasopressin-Glutamate Pathway?. Front Neural Circuits. 2016;10:13 pubmed publisher
immunoprecipitation; rat; fig s10 western blot; rat; 1:6000; fig s10	Schwenk J, PÃ©rez Garci E, Schneider A, Kollewe A, Gauthier Kemper A, Fritzius T, et al. Modular composition and dynamics of native GABAB receptors identified by high-resolution proteomics. Nat Neurosci. 2016;19:233-42 pubmed publisher
	Akyüz E, Doğanyiğit Z, Paudel Y, Koklu B, Kaymak E, Villa C, et al. Immunoreactivity of Muscarinic Acetylcholine M2 and Serotonin 5-HT2B Receptors, Norepinephrine Transporter and Kir Channels in a Model of Epilepsy. Life (Basel). 2021;11: pubmed publisher
	Mett A, Karbat I, Tsoory M, Fine S, Iwanir S, Reuveny E. Reduced activity of GIRK1-containing heterotetramers is sufficient to affect neuronal functions, including synaptic plasticity and spatial learning and memory. J Physiol. 2021;599:521-545 pubmed publisher
	Aky xfc z E, Do x11f anyi x11f it Z, Paudel Y, Kaymak E, Yılmaz S, Uner A, et al. Increased ACh-Associated Immunoreactivity in Autonomic Centers in PTZ Kindling Model of Epilepsy. Biomedicines. 2020;8: pubmed publisher
	Xie D, Geng L, Xiong K, Zhao T, Wang S, Xue J, et al. Cold-Inducible RNA-Binding Protein Prevents an Excessive Heart Rate Response to Stress by Targeting Phosphodiesterase. Circ Res. 2020;126:1706-1720 pubmed publisher
	Akyüz E, Villa C, Beker M, Elibol B. Unraveling the Role of Inwardly Rectifying Potassium Channels in the Hippocampus of an Aβ(1-42)-Infused Rat Model of Alzheimer's Disease. Biomedicines. 2020;8: pubmed publisher
	Zhang D, Hu X, Li J, Liu J, Baks Te Bulte L, Wiersma M, et al. DNA damage-induced PARP1 activation confers cardiomyocyte dysfunction through NAD+ depletion in experimental atrial fibrillation. Nat Commun. 2019;10:1307 pubmed publisher
	Sánchez Rodríguez I, Temprano Carazo S, Najera A, Djebari S, Yajeya J, Gruart A, et al. Activation of G-protein-gated inwardly rectifying potassium (Kir3/GirK) channels rescues hippocampal functions in a mouse model of early amyloid-β pathology. Sci Rep. 2017;7:14658 pubmed publisher
	May L, Anggono V, Gooch H, Jang S, Matusica D, Kerbler G, et al. G-Protein-Coupled Inwardly Rectifying Potassium (GIRK) Channel Activation by the p75 Neurotrophin Receptor Is Required for Amyloid β Toxicity. Front Neurosci. 2017;11:455 pubmed publisher
	Kleschevnikov A, Yu J, Kim J, Lysenko L, Zeng Z, Yu Y, et al. Evidence that increased Kcnj6 gene dose is necessary for deficits in behavior and dentate gyrus synaptic plasticity in the Ts65Dn mouse model of Down syndrome. Neurobiol Dis. 2017;103:1-10 pubmed publisher
	Kammerer S, Jahn S, Winter E, Eidenhammer S, Rezania S, Regitnig P, et al. Critical evaluation of KCNJ3 gene product detection in human breast cancer: mRNA in situ hybridisation is superior to immunohistochemistry. J Clin Pathol. 2016;69:1116-1121 pubmed publisher
	Booker S, Althof D, Gross A, Loreth D, MÃ¼ller J, Unger A, et al. KCTD12 Auxiliary Proteins Modulate Kinetics of GABAB Receptor-Mediated Inhibition in Cholecystokinin-Containing Interneurons. Cereb Cortex. 2017;27:2318-2334 pubmed publisher
	Robertson D, Sleno R, Nagi K, PÃ©trin D, HÃ©bert T, Pineyro G. Design and construction of conformational biosensors to monitor ion channel activation: A prototype FlAsH/BRET-approach to Kir3 channels. Methods. 2016;92:19-35 pubmed publisher

image

image 1 :

Western blot analysis of rat brain membranes: - 1. Anti-GIRK1 (Kir3.1) Antibody (#APC-005), (1:200).2. Anti-GIRK1 (Kir3.1) Antibody, preincubated with the control antigen.

image 2 :

GST fusion protein with the sequence LQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKMNSDRFT corresponding to residues 437-501 of mouse GIRK1 (AccessionP63250).Intracellular C-terminus.

image 3 :

Alomone Labs Picrotoxin inhibits GABA(A) receptors expressed inXenopusoocytes. - Representative time course of GABA(A) ?1/?2 current activated by a continuous application (top dotted line) of 0.1 M ?-aminobutyric acid (#G-110) and inhibited by 10 M Picrotoxin (#P-325) as indicated (bar) at a holding potential of -60 mV.

product information

CAT :

APC-005

SKU :

APC-005-CF_0.2 ml

Product Name :

Anti-GIRK1 (Kir3.1) Antibody

Group Type :

Antibodies

Product Type :

Antibodies

Clonality :

Polyclonal

Accession :

P63250

Applications :

IC IF IHC IP WB

Reactivity :

Human Rat Mouse

Host :

Rabbit

Blocking Peptide :

BLP-PC005

Homology :

Rat - identical; human - 64/66 amino acid residues identical; guinea pig - 63/66 amino acid residues identical; chicken - 59/66 amino acid residues identical

Formulation :

PBS pH7.4

isotype :

Rabbit IgG

Peptide confirmation :

Confirmed by DNA sequence and SDS-PAGE

Reconstitution :

0.2 ml double distilled water (DDW).

Antibody Concentration After Reconstitut ... :

1 mg/ml

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods, small aliquots should be stored at -20°C. Avoid multiple freezing and thawing. Centrifuge all antibody preparations before use (10000 x g 5 min).

Preservative :

No Preservative

Immunogen Location :

Intracellular, C-terminus

Label :

Unconjugated

Storage Before Reconstitution :

The antibody ships as a lyophilized powder at room temperature. Upon arrival, it should be stored at -20°C

Shipping and storage :

Shipped at room temperature. Product as supplied can be stored intact at room temperature for several weeks. For longer periods, it should be stored at -20°C

immunogen source species :

Mouse

Sequence :

corresponding to residues 437-501 of mouse GIRK1
LQRISSVPGNSEEKLVSKTTKMLSDPMSQSVADLPPKLQ
KMAGGPTRMEGNLPAKLRKMNSDRFT,
GST fusion protein with the sequence

Product Page - Scientific background :

Kir3.1 (or G-protein regulated inward-rectifier K+ channel 1, GIRK1) is a member of the family of inward rectifying K+ channels. The family includes 15 members that are structurally and functionally different from the voltage-dependent K+ channels.The family's topology consists of two transmembrane domains that flank a single and highly conserved pore region with intracellular N- and C-termini. As is the case for the voltage-dependent K+ channels, the functional unit for the Kir channels is composed of four subunits that can assemble as either homo- or heterotetramers.Kir channels are characterized by a K+ efflux that is limited by depolarizing membrane potentials thus making them essential for controlling resting membrane potential and K+ homeostasis.Kir3.1 is a member of the Kir3.x subfamily that includes four members (Kir3.1- Kir3.4). The Kir3 family is characterized by the fact that the channels can be activated by neurotransmitters and other factors acting via the activation of G-protein coupled receptors. Binding of the corresponding ligand to the G-protein receptor induces the dissociation of Gα-GTP from the Gβγ dimer. The latter directly binds to Kir3 and activates the channel1,3.In the heart, Kir3.1 co-assembles with Kir3.4 to form the prototypical muscarinic-gated K+ channel KAch current, responsible for slowing the heart rate in response of parasympathetic stimulation2.In the brain, Kir3.1 co-assembles with Kir3.2 and mediates the inhibitory effects of many neurotransmitters including opioid, adrenergic, muscarinic, dopaminergic and γ-aminobutyric acid (GABA)1,3.A peptide toxin originating from the Apis mellifera bee venom, Tertiapin (#STT-250) was shown to be a potent blocker of Kir3.1 containing channels (8.6 nM for the Kir3.1/3.4 combination and 5.4 nM for the Kir3.1/3.2)4,5.

Applications may also work in :

IC IF IHC IP WB

Supplier :

Alomone Labs

Target :

KCNJ3, G protein-activated inward rectifier potassium channel 1

Short Description :

A Rabbit Polyclonal Antibody to GIRK1 (Kir3.1) Channel

Long Description :

Anti-GIRK1 (Kir3.1) Antibody (#APC-005) is a highly specific antibody directed against an epitope of the mouse protein. The antibody can be used in western blot, immunprecipitation, immunocytochemistry, and immunohistochemistry applications. It has been designed to recognize Kir3.1 from human, rat, and mouse samples.

Negative Control :

BLP-PC005

Positive Control :

Synonyms :

KCNJ3, G protein-activated inward rectifier potassium channel 1

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Applications key :

CBE- Cell-based ELISA, FC- Flow cytometry, ICC- Immunocytochemistry, IE- Indirect ELISA, IF- Immunofluorescence, IFC- Indirect flow cytometry, IHC- Immunohistochemistry, IP- Immunoprecipitation, LCI- Live cell imaging, N- Neutralization, WB- Western blot

Specifictiy :

KCNJ3

Form :

Lyophilized powder. Reconstituted antibody contains phosphate buffered saline (PBS), pH 7.4.

Comment :

Contact Alomone Labs for technical support and product customization

Species reactivity key :

H- Human, M- Mouse, R- Rat

Is Toxin :

Purity :

The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and then the IgG fraction was purified on immobilized antigen.

UNSPSC :

41116161

KO-Validated :

yes

Cited Application :

IP ICC

Clone :

Standard quality control of each lot :

Western blot analysis

Antigen preadsorption control :

3 µg fusion protein per 1 µg antibody

Application Dilutions: Immunohistochemis ... :

Contact Alomone for information

Application Dilutions: Western blot wb :

1:200

more info or order :

Alomone Labs product webpage