product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Wasabi Receptor Toxin
catalog :
STW-200
more info or order :
image
image 1 :

ManufacturerBioassayAlomone Labs Wasabi receptor toxin leads to Ca2+ signals in HEK 293 cells transfected with TRPA1. - A. Upper, individual traces (grey) and mean trace (black) of changes in intracellular Ca2+ concentration with time (measured as a change in FURA-2AM fluorescent intensity) in HEK 293 cells transfected with human TRPA1, following application of 5 µM Wasabi receptor toxin (#STW-200) followed by 200 µM AITC. Bottom, Mean ± SEM of changes in intracellular Ca2+ in HEK 293 cells transfected with human TRPA1, following application of 5 µM Wasabi receptor toxin followed by 200 µM AITC. n = 42 cells, representative of 5 plates. B. Same as in A, but in untransfected HEK 293 cells. Ionomycin was added at the end of each experiment. n = 60 cells, representative of 3 plates. Figure kindly provided by Prof. Alexander Binshtok, Dept. Medical Neurobiology, Institute for Medical Research, IMRIC, Hebrew University School of Medicine, Jerusalem.
product information
cat :
STW-200
SKU :
STW-200_0.1 mg
Product Name :
Wasabi Receptor Toxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
C0HLG4
Accession Number :
https://www.uniprot.org/uniprotkb/C0HLG4/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Urodacus manicatus (Black rock scorpion)
Source :
Synthetic peptide
Gene ID :
TRPA1
Product Page - Scientific background :
Wasabi receptor toxin (WaTx) is a peptide toxin originally isolated from Urodacus manicatus (Australian Black Rock scorpion) venoM The peptide toxin activates TRPA1 channel by a novel mechanism: it penetrates the cell and stabilizes the channel's open state, thereby causing pain1.TRPA1 ion channel is a chemosensory receptor for a broad class of volatile environmental irritants. It is expressed in sensory neurons and activated by natural products from mustard and allium plants. This activation elicits the sinus clearing or eye stinging pain one experiences when eating wasabi or chopping an onion2.TRPA1 is also a sensor for endogenous inflammatory agents that directly activate this channel to produce acute and persistent pain2. TRPA1 is considered a promising therapeutic target for treating chronic pain, itch, and neurogenic inflammatory syndromes3.
Supplier :
Alomone Labs
Target :
TRPA1 channel
Long Description :
A Cell-Penetrating Activator of TRPA1 Channel
Short Description :
A Cell-Penetrating Activator of TRPA1 Channel
MW :
3855.3 Da
Synonyms :
WaTx
Modifications :
Disulfide bonds between: Cys44-Cys62, Cys48-Cys58
Molecular formula :
C164H245N45O53S5
Effective Concentration :
0.5 - 5 µM
Activity :
Wasabi Receptor Toxin is a cell penetrating peptide toxin activator of TRPA1 Channel1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
CAS No :
2569291-86-5
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
related products
browse more products
questions and comments