chemical

ADWX-1

STW-100

STW-100_0.1 mg

ADWX-1

Non Antibodies

Proteins

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Synthetic peptide

KCNA3

KV1.3 channel is an attractive pharmacological target for immunomodulation of T cell-mediated autoimmune diseases. ADWX-1 peptide is a potent and selective KV1.3 channel blocker. ADWX-1 peptide is a synthetic analog of the scorpion peptide BmKTx. This peptide is based on the natural BmKTX in which three important residues were mutated in a structure-modification strategy to enhance the KV1.3 channel selectivity1. ADWX-1 inhibits KV1.3 channels heterologously expressed in HEK-293 cells. ADWX-1 blocks KV1.3 currents with an IC50 of 0.0019 nM and displays specificity for KV1.3 over KV1.1 and KV1.2 (IC50 values are 0.65 nM).ADWX-1 inhibits CD4+ CCR7- T-cell proliferation.ADWX-1 is an interesting therapeutic candidate to treat auto-immune disorders such as multiple sclerosis, type-1 diabetes, rheumatoid arthritis and psoriasis. This peptide is a valuable tool for studying the structure-function of KV1.3 channel and auto-immunity pathways2.

Alomone Labs

KV1.3 K+ channel

A Blocker KV1.3 K+ Channels

A Blocker KV1.3 K+ Channels

4072 Da

ADWX1, ADWX 1

Disulfide bonds between: Cys7-Cys27, Cys13-Cys32, and Cys17-Cys34

C169H281N57O46S7

1 pM - 2 nM

Selective potent KV1.3 blocker1-3.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK-OH

Yes

12352202

yes

no