product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
ADWX-1
catalog :
STW-100
more info or order :
image
image 1 :

Expression of Neuregulin-1 in rat neocortex - Immunohistochemical staining of perfusion-fixed frozen rat brain sections using Anti-NRG1 (Neuregulin-1) (extracellular)Antibody (#ANR-111) (1:1000) followed by anti-rabbit-biotinylated antibody and streptavidin-Cy3 (red). Neuregulin-1 staining is strong in processes of various cell types (horizontal arrows) and less intense in neuron-shaped soma (vertical arrows). Nuclei are stained with DAPI (blue).
image 2 :

Alomone LabsADWX-1 inhibits KV1.3 currents heterologously expressed inXenopusoocytes. - A. Time course ofADWX-1(#STW-100) blocking action on KV1.3 currents. Membrane potential was held at -80 mV and cells were stimulated by a 100 ms voltage ramp to +40 mV. 1 nM ADWX-1 was perfused as indicated by the bar (green) at +35 mV. B. Superimposed examples of KV1.3 channel current in the absence (control) and presence (green) of 1 nM ADWX-1 (taken from the experiment in A).
product information
cat :
STW-100
SKU :
STW-100_0.1 mg
Product Name :
ADWX-1
Group Type :
Non Antibodies
Product Type :
Proteins
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Source :
Synthetic peptide
Gene ID :
KCNA3
Product Page - Scientific background :
KV1.3 channel is an attractive pharmacological target for immunomodulation of T cell-mediated autoimmune diseases. ADWX-1 peptide is a potent and selective KV1.3 channel blocker. ADWX-1 peptide is a synthetic analog of the scorpion peptide BmKTx. This peptide is based on the natural BmKTX in which three important residues were mutated in a structure-modification strategy to enhance the KV1.3 channel selectivity1. ADWX-1 inhibits KV1.3 channels heterologously expressed in HEK-293 cells. ADWX-1 blocks KV1.3 currents with an IC50 of 0.0019 nM and displays specificity for KV1.3 over KV1.1 and KV1.2 (IC50 values are 0.65 nM).ADWX-1 inhibits CD4+ CCR7- T-cell proliferation.ADWX-1 is an interesting therapeutic candidate to treat auto-immune disorders such as multiple sclerosis, type-1 diabetes, rheumatoid arthritis and psoriasis. This peptide is a valuable tool for studying the structure-function of KV1.3 channel and auto-immunity pathways2.
Supplier :
Alomone Labs
Target :
KV1.3 K+ channel
Long Description :
A Blocker KV1.3 K+ Channels
Short Description :
A Blocker KV1.3 K+ Channels
MW :
4072 Da
Synonyms :
ADWX1, ADWX 1
Modifications :
Disulfide bonds between: Cys7-Cys27, Cys13-Cys32, and Cys17-Cys34
Molecular formula :
C169H281N57O46S7
Effective Concentration :
1 pM - 2 nM
Activity :
Selective potent KV1.3 blocker1-3.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
VGINVKCKHSRQCLKPCKDAGMRFGKCTNGKCHCTPK-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
related products
browse more products
questions and comments