product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Urotoxin
catalog :
STU-200
more info or order :
citations: 1
product information
cat :
STU-200
SKU :
STU-200_0.1 mg
Product Name :
Urotoxin
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0DL37
Accession Number :
https://www.uniprot.org/uniprotkb/P0DL37/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Urodacus yaschenkoi (Inland robust scorpion)
Source :
Synthetic peptide
Gene ID :
KCNA1 ,KCNA2 ,KCNA3,KCNN4
Product Page - Scientific background :
Urotoxin is a peptide toxin originally isolated from Urodacus yaschenkoi Australian Scorpion venoM Urotoxin is an extremely potent blocker of human voltage-gated potassium channel KV1.2 channels with IC50 values of 160 pM However, it also displays activity towards KV1.1, KV1.3 and KCa3.1 with IC50 values of 253 nM, 91 nM and 70 nM respectively1.Potassium channels are membrane proteins found in excitable and nonexcitable cells. KV1.2 channel plays an important role in the maintenance of resting membrane potential and the regulation of the cellular excitability of neurons1,2.
Supplier :
Alomone Labs
Target :
KV1.2, KV1.1, KV1.3, KCa3.1 channels
Long Description :
A Super Potent Blocker of KV1.2 Channel
Short Description :
A Super Potent Blocker of KV1.2 Channel
MW :
4012.8 Da
Synonyms :
Potassium channel toxin alpha-KTx 6.21
Modifications :
Disulfide bonds between: Cys5-Cys26, Cys11-Cys31, Cys15-Cys33 and Cys21-Cys36 Val37 - C-terminal amidation
Molecular formula :
C161H260N52O50S9
Effective Concentration :
50 pM - 1 nM
Activity :
Urotoxin is a potent KV1.2 channel blocker. The toxin also blocks KV1.1, KV.3 and KCa3.1 channels.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
GDIKCSGTRQCWGPCKKQTTCTNSKCMNGKCKCYGCV-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments