chemical

Urotoxin

STU-200

STU-200_0.1 mg

Urotoxin

Non Antibodies

Proteins

P0DL37

https://www.uniprot.org/uniprotkb/P0DL37/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Urodacus yaschenkoi (Inland robust scorpion)

Synthetic peptide

KCNA1 ,KCNA2 ,KCNA3,KCNN4

Urotoxin is a peptide toxin originally isolated from Urodacus yaschenkoi Australian Scorpion venoM Urotoxin is an extremely potent blocker of human voltage-gated potassium channel KV1.2 channels with IC50 values of 160 pM However, it also displays activity towards KV1.1, KV1.3 and KCa3.1 with IC50 values of 253 nM, 91 nM and 70 nM respectively1.Potassium channels are membrane proteins found in excitable and nonexcitable cells. KV1.2 channel plays an important role in the maintenance of resting membrane potential and the regulation of the cellular excitability of neurons1,2.

Alomone Labs

KV1.2, KV1.1, KV1.3, KCa3.1 channels

A Super Potent Blocker of KV1.2 Channel

A Super Potent Blocker of KV1.2 Channel

4012.8 Da

Potassium channel toxin alpha-KTx 6.21

Disulfide bonds between: Cys5-Cys26, Cys11-Cys31, Cys15-Cys33 and Cys21-Cys36 Val37 - C-terminal amidation

C161H260N52O50S9

50 pM - 1 nM

Urotoxin is a potent KV1.2 channel blocker. The toxin also blocks KV1.1, KV.3 and KCa3.1 channels.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

GDIKCSGTRQCWGPCKKQTTCTNSKCMNGKCKCYGCV-NH2

Yes

12352202

yes

no