Tamapin | Alomone Labs STT-400 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Tamapin

catalog :

STT-400

more info or order :

Alomone Labs product webpage

citations: 4

Reference
Voos P, Fuck S, Weipert F, Babel L, Tandl D, Meckel T, et al. Ionizing Radiation Induces Morphological Changes and Immunological Modulation of Jurkat Cells. Front Immunol. 2018;9:922 pubmed publisher
Siddiqui T, Lively S, Ferreira R, Wong R, Schlichter L. Expression and contributions of TRPM7 and KCa2.3/SK3 channels to the increased migration and invasion of microglia in anti-inflammatory activation states. PLoS ONE. 2014;9:e106087 pubmed publisher
Chubanov V, Mederos y Schnitzler M, Meisner M, Schafer S, Abstiens K, Hofmann T, et al. Natural and synthetic modulators of SK (K(ca)2) potassium channels inhibit magnesium-dependent activity of the kinase-coupled cation channel TRPM7. Br J Pharmacol. 2012;166:1357-76 pubmed publisher
Schlichter L, Kaushal V, Moxon Emre I, Sivagnanam V, Vincent C. The Ca2+ activated SK3 channel is expressed in microglia in the rat striatum and contributes to microglia-mediated neurotoxicity in vitro. J Neuroinflammation. 2010;7:4 pubmed publisher

image

image 1 :

Alomone Labs Tamapin completely inhibits KCa2.2 (SK2) currents heterologously expressed inXenopusoocytes. - Current traces recorded at +5 mV. At the indicated time (arrow) 25 nl of 100 mM CaCl2was injected into the oocyte in order to activate outward current. 100 nMTamapin(#STT-400) were perfused for 1 min (green) to completely inhibit the current.

product information

cat :

STT-400

SKU :

STT-400_0.1 mg

Product Name :

Tamapin

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P59869

Accession Number :

https://www.uniprot.org/uniprotkb/P59869/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Hottentotta tamulus (Eastern Indian scorpion) (Mesobuthus tamulus)

Source :

Synthetic peptide

Gene ID :

KCNN1,KCNN2,KCNN3

Product Page - Scientific background :

Tamapin is a 31 amino acid peptidyl toxin, isolated from the venom of the Indian red scorpion, Mesobuthus tamulus, and is classified as α-5.4 scorpion toxin family1 with three disulfide bridges. Native Tamapin blocks KCa2 channels in pyramidal neurons of the hippocampus as well as in cell lines expressing distinct KCa2 channel subunits. Tamapin displays a remarkable selectivity for KCa2.2 (SK2/KCNN2, IC50 = 24 pM) versus KCa2.1 (SK1/KCNN1, approx 1750 fold) and KCa2.3 (SK3/KCNN3) channels2.

Supplier :

Alomone Labs

Target :

KCa2 K+ channels

Long Description :

A Blocker of KCa2 Channels

Short Description :

A Blocker of KCa2 Channels

MW :

3458.2 Da

Synonyms :

K+ channel toxin α-KTx 5.4

Modifications :

Disulfide bonds between: Cys3-Cys21, Cys8-Cys26, and Cys12-Cys28 Tyr31 - C-terminal amidation

Molecular formula :

C146H238N44O41S6

Effective Concentration :

500 pM - 50 nM

Activity :

Tamapin blocks KCa2 channels. Tamapin displays a remarkable selectivity for KCa2.2 versus KCa2.1 channels1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

CAS No :

508220-81-3

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

AFCNLRRCELSCRSLGLLGKCIGEECKCVPY-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage