Tityustoxin-Kα | Alomone Labs STT-360 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Tityustoxin-Kα

catalog :

STT-360

more info or order :

Alomone Labs product webpage

citations: 5

Reference
Smith K, Browne L, Selwood D, McAlpine D, Jagger D. Phosphoinositide Modulation of Heteromeric Kv1 Channels Adjusts Output of Spiral Ganglion Neurons from Hearing Mice. J Neurosci. 2015;35:11221-32 pubmed publisher
Wang T, Lee M, Choi E, Pardo Villamizar C, Lee S, Yang I, et al. Granzyme B-induced neurotoxicity is mediated via activation of PAR-1 receptor and Kv1.3 channel. PLoS ONE. 2012;7:e43950 pubmed publisher
Martel P, Leo D, Fulton S, Bérard M, Trudeau L. Role of Kv1 potassium channels in regulating dopamine release and presynaptic D2 receptor function. PLoS ONE. 2011;6:e20402 pubmed publisher
Al Sabi A, Shamotienko O, Dhochartaigh S, Muniyappa N, Le Berre M, Shaban H, et al. Arrangement of Kv1 alpha subunits dictates sensitivity to tetraethylammonium. J Gen Physiol. 2010;136:273-82 pubmed publisher
Madrid R, De La Pena E, Donovan Rodriguez T, Belmonte C, Viana F. Variable threshold of trigeminal cold-thermosensitive neurons is determined by a balance between TRPM8 and Kv1 potassium channels. J Neurosci. 2009;29:3120-31 pubmed publisher

image

image 1 :

Alomone Labs Tityustoxin-K? inhibits KV1.2 currents in Xenopus oocytes. - A. Time course ofTityustoxin-K?(#STT-360) action on KV1.2 currents. Plateau current amplitudes were plotted as a function of time. Membrane potential was held at ?100 mV and oocytes were stimulated by a 100 ms voltage step to +20 mV. 1 nM Tityustoxin-K? was perfused as indicated by the bar (green). B. Superimposed examples of KV1.2 channel current in the absence (control) and presence of 1 nM Tityustoxin-K? (taken from the experiment in A).

product information

cat :

STT-360

SKU :

STT-360_0.1 mg

Product Name :

Tityustoxin-Kα

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P46114

Accession Number :

https://www.uniprot.org/uniprotkb/P46114/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Tityus serrulatus (Brazilian scorpion)

Source :

Synthetic peptide

Gene ID :

KCNA1,KCNA2,KCNA3,KCNA6

Product Page - Scientific background :

Tityustoxin-Kα was originally isolated from the scorpion Tityus serrulatus, and was shown to block cloned KV1.2 with high potency.1 It inhibits stably expressed KV1.2 channels in fibroblast cell line as assessed by patch clamp with Kd of 0.21 nM1. Tityustoxin-Kα also reduced the binding of 125I-α-Dendrotoxin to synaptosomal membranes2.

Supplier :

Alomone Labs

Target :

KV1.2 K+ channels

Long Description :

A KV1.2 Channel Blocker

Short Description :

A KV1.2 Channel Blocker

MW :

3941.8 Da

Synonyms :

K+ channel toxin α-KTx 4.1, TsTX-K-α, TSK4, Toxin II-9

Modifications :

Disulfide bonds between: Cys7-Cys28, Cys13-Cys33 and Cys17-Cys35

Molecular formula :

C168H275N49O46S7

Effective Concentration :

0.5 - 50 nM

Activity :

Tityustoxin-Kα blocks cloned KV1.2 with high potency1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥99% (HPLC)

CAS No :

39465-37-7

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

VFINAKCRGSPECLPKCKEAIGKAAGKCMNGKCKCYP-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage