product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Tityustoxin-Kα
catalog :
STT-360
more info or order :
citations: 5
| Reference |
|---|
image
image 1 :

Alomone Labs Tityustoxin-K? inhibits KV1.2 currents in Xenopus oocytes. - A. Time course ofTityustoxin-K?(#STT-360) action on KV1.2 currents. Plateau current amplitudes were plotted as a function of time. Membrane potential was held at ?100 mV and oocytes were stimulated by a 100 ms voltage step to +20 mV. 1 nM Tityustoxin-K? was perfused as indicated by the bar (green). B. Superimposed examples of KV1.2 channel current in the absence (control) and presence of 1 nM Tityustoxin-K? (taken from the experiment in A).
product information
cat :
STT-360
SKU :
STT-360_0.1 mg
Product Name :
Tityustoxin-Kα
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P46114
Accession Number :
https://www.uniprot.org/uniprotkb/P46114/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Tityus serrulatus (Brazilian scorpion)
Source :
Synthetic peptide
Gene ID :
KCNA1,KCNA2,KCNA3,KCNA6
Product Page - Scientific background :
Tityustoxin-Kα was originally isolated from the scorpion Tityus serrulatus, and was shown to block cloned KV1.2 with high potency.1 It inhibits stably expressed KV1.2 channels in fibroblast cell line as assessed by patch clamp with Kd of 0.21 nM1. Tityustoxin-Kα also reduced the binding of 125I-α-Dendrotoxin to synaptosomal membranes2.
Supplier :
Alomone Labs
Target :
KV1.2 K+ channels
Long Description :
A KV1.2 Channel Blocker
Short Description :
A KV1.2 Channel Blocker
MW :
3941.8 Da
Synonyms :
K+ channel toxin α-KTx 4.1, TsTX-K-α, TSK4, Toxin II-9
Modifications :
Disulfide bonds between: Cys7-Cys28, Cys13-Cys33 and Cys17-Cys35
Molecular formula :
C168H275N49O46S7
Effective Concentration :
0.5 - 50 nM
Activity :
Tityustoxin-Kα blocks cloned KV1.2 with high potency1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥99% (HPLC)
CAS No :
39465-37-7
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
VFINAKCRGSPECLPKCKEAIGKAAGKCMNGKCKCYP-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
