Tityustoxin-Kα-ATTO Fluor-594 | Alomone Labs STT-360-AR product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Tityustoxin-Kα-ATTO Fluor-594

catalog :

STT-360-AR

more info or order :

Alomone Labs product webpage

citations: 1

Reference
Williams M, Fuchs J, Green J, Morielli A. Cellular mechanisms and behavioral consequences of Kv1.2 regulation in the rat cerebellum. J Neurosci. 2012;32:9228-37 pubmed publisher

image

image 1 :

Alomone Labs Tityustoxin-K?-ATTO-594 labels surface Kv1.2 channels in the cerebellar pinceaus of rat cerebellar slices. - Overnight incubation of fixed rat cerebellar slices in 3 nMTityustoxin K?-ATTO-594(#STT-360-AR) gives positive signal in the molecular layer and in the pinceaus of BC axon terminals. Scale bar 10 m.Adapted from Figure 4 in Williams M.R. et al.

image 2 :

Tityustoxin-K?-ATTO-594 labels KV1.2 channel in mouse cerebellum. - A. Staining of free-floating mouse brain sections usingTityustoxin-K?-ATTO-594(#STT-360-AR) (red). Sections were then stained usingAnti-KV1.2 (KCNA2) Antibody(#APC-010) (1:200) followed by goat anti-rabbit-AlexaFluor-488 (green). Tityustoxin-K?-ATTO-594 and KV1.2 are both detected in the pinceau structures (yellow staining arrow) of the cerebellum. B. Same brain sections as in A were labeled with Tityustoxin-K?-ATTO-594 (red) followed by anti-Parvalbumin. Tityustoxin-K?-ATTO-594 (red) labeled the pinceau structures (arrow) of the cerebellum. Parvalbumin stained not only the pinceau but also the soma of Purkinje cells.Co-localization between the two is depicted in yellow.

image 3 :

Alomone Labs Tityustoxin-K?-ATTO-594 binds KV1.2 including ?2 transfected HEK293T cells and is displaced by unlabeled Tityustoxin-K?. - HEK293T cells transfected with KV1.2 and?2 were incubated with 200 nMTityustoxin-K?-ATTO-594(#STT-360-AR) in the absence (AB) and presence (CD) of 5MTityustoxin-K?(#STT-360). Similar results were observed by using 100 nM Tityustoxin-K?-ATTO-594 (data not shown).

product information

cat :

STT-360-AR

SKU :

STT-360-AR_5 mcg

Product Name :

Tityustoxin-Kα-ATTO Fluor-594

Group Type :

Non Antibodies

Product Type :

Proteins

Applications :

Electrophysiology, Live cell imaging, Immunofluorescence, Fluorescence staining, Direct flow cytometry

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

Store the reconstituted solution at -20°C for the shortest time possible. Avoid multiple freeze-thaw cycles. We do not recommend storing the product in working solutions for longer than a day. Avoid exposure to light.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is lyophilized in 0.5 ml conical vial. The product is soluble in pure water to high-micromolar concentrations (5 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity. Avoid exposure to light.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Tityus serrulatus (Brazilian scorpion)

Source :

Modified synthetic peptide

Gene ID :

KCNA1,KCNA2,KCNA3,KCNA6

Product Page - Scientific background :

Tityustoxin Kα (#STT-360) is a potent and specific blocker of KV1.2 channels1,2. It was originally isolated from the scorpion Tityus serrulatus venom2.The labeled version of the toxin, Tityustoxin-Kα-ATTO Fluor-594, has been tested in electrophysiology applications and is specially suited to experiments requiring simultaneous labeling of different markers.

Supplier :

Alomone Labs

Target :

KV1.2 K+ channels

Long Description :

A KV1.2 K+ Channel Blocker Conjugated to the Fluorescent Dye ATTO-594

Short Description :

A KV1.2 K+ Channel Blocker Conjugated to the Fluorescent Dye ATTO-594

MW :

~4900 Da

Synonyms :

K+ channel toxin α-KTx 4.1, TsTX-K-α, TSK4, Toxin II-9

Modifications :

Disulfide bonds between: Cys7-Cys28, Cys13-Cys33 and Cys17-Cys35 Ala20 was replaced by Cysteine (bold in the sequence). ATTO Fluor-594

Effective Concentration :

0.5 - 50 nM

Activity :

Tityustoxin-Kα blocks cloned KV1.2 with high potency1,2.Using Alomone labs Tityustoxin-Kα-ATTO Fluor-594 in microscopy technique, Williams R.W. et al. showed recently that stimulating adenylate cyclase (AC) decreased surface KV1.2 within the pinceaus of cerebellar basket cell (BC) axon terminals3.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

VFINAKCRGSPECLPKCKEAIGKAAGKCMNGKCKCYP-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage