This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Alomone Labs
product type :
chemical
product name :
VSTX3
catalog :
STT-350
product information
cat :
STT-350
SKU :
STT-350_0.1 mg
Product Name :
VSTX3
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
P0C2P5
Accession Number :
https://www.uniprot.org/uniprotkb/P0C2P5/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Grammostola rosea (Chilean rose tarantula) (Phrixotrichus auratus)(Grammostola spatulata)
Source :
Synthetic peptide
Gene ID :
SCN10A,SCN3A,SCN9A
Product Page - Scientific background :
VSTX3 was originally isolated from the Grammostola spatulata spider venom1 and is also isolated from the Phrixotrichus auratus spider venom2.VSTX3 was first isolated and shown to bind through its affinity to the voltage-sensor domain of KvAP channels1.VSTX3 also inhibits voltage-gated rat NaV1.3, NaV1.7 and NaV1.8 Na+ channels2.Voltage-gated sodium channels (VGSC, NaV) play a critical role in excitability of nociceptors (pain-sensing neurons). The peripheral-specific sodium channels NaV1.7, NaV1.8 and NaV1.9 are particularly important in the pathophysiology of different pain syndromes and hence, thought to be potential targets for pain therapeutics3,4.The expression and functional properties of NaV channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation5.VSTX3 shows high homology to Ceratotoxin-1 (75%), Ceratotoxin-2 (#STC-100) (77%) and Pterinotoxin-1 (#STT-100) (83%).
Supplier :
Alomone Labs
Target :
NaV1.3, NaV1.7, NaV1.8 Na+ channels
Long Description :
A Blocker of NaV1.3, NaV1.7, NaV1.8 Voltage-Gated Na+ Channels
Short Description :
A Blocker of NaV1.3, NaV1.7, NaV1.8 Voltage-Gated Na+ Channels
MW :
4171.8 Da
Synonyms :
κ-Theraphotoxin-Gr4a, Kappa-TRTX-Gr4a, Voltage sensor toxin 3, Peptide F
Modifications :
Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29
Molecular formula :
C182H261N51O51S6
Effective Concentration :
200 - 500 nM
Activity :
VSTX3 inhibits voltage-gated Na+ channels NaV1.3, NaV1.7 and NaV1.81.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
DCLGWFKGCDPDNDKCCEGYKCNRRDKWCKYKLW-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel