VSTX3 | Alomone Labs STT-350 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

VSTX3

catalog :

STT-350

more info or order :

Alomone Labs product webpage

image

image 1 :

Alomone Labs VSTX3inhibits rNaV1.3 and rNaV1.8 channels heterologously expressed in HEK293 and ND7-23 cells respectively. - A. Dose-response of NaVchannels inhibition byVSTX3(#STT-350). The inhibition was measured in 3-5 cells for each dose in rat NaV1.3 channels expressed in HEK293 cells (open circles) and 3-5 cells for rat NaV1.8 expressed in ND7-23 cells (open square) in the presence of 600 nMTetrodotoxincitrate (#T-550). B. Example of superimposed current traces of rat NaV1.3 channel activity before (black) and during (green) application of 0.1 M VSTX3. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 40 msec from holding potential to +60 mV. C. Example of superimposed current traces of rat NaV1.8 channel activity before (black) and during (green) application of 0.5 M VSTX3 both in the presence of 600 nM Tetrodotoxin(with citrate). The same voltage protocol was used as in graph B.

image 2 :

Alomone Labs Jingzhaotoxin-IX blocks NaV1.5 channels heterologously expressed inXenopusoocytes. - A. Time course ofJingzhaotoxin-IX(#STJ-300) action on NaV1.5 currents. Peak current amplitude at -20 mV was plotted as a function of time. Membrane potential was held at -100 mV and oocytes were stimulated by a 50 ms voltage step to -20 mV. 1 M Jingzhaotoxin-IX (applied for 4.5 min green) was perfused during the period marked by the bar. B. Superimposed traces of channel current in the absence (black) and presence (green) of 1 M Jingzhaotoxin-IX (taken from experiment in A).

product information

cat :

STT-350

SKU :

STT-350_0.1 mg

Product Name :

VSTX3

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P0C2P5

Accession Number :

https://www.uniprot.org/uniprotkb/P0C2P5/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Grammostola rosea (Chilean rose tarantula) (Phrixotrichus auratus)(Grammostola spatulata)

Source :

Synthetic peptide

Gene ID :

SCN10A,SCN3A,SCN9A

Product Page - Scientific background :

VSTX3 was originally isolated from the Grammostola spatulata spider venom1 and is also isolated from the Phrixotrichus auratus spider venom2.VSTX3 was first isolated and shown to bind through its affinity to the voltage-sensor domain of KvAP channels1.VSTX3 also inhibits voltage-gated rat NaV1.3, NaV1.7 and NaV1.8 Na+ channels2.Voltage-gated sodium channels (VGSC, NaV) play a critical role in excitability of nociceptors (pain-sensing neurons). The peripheral-specific sodium channels NaV1.7, NaV1.8 and NaV1.9 are particularly important in the pathophysiology of different pain syndromes and hence, thought to be potential targets for pain therapeutics3,4.The expression and functional properties of NaV channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation5.VSTX3 shows high homology to Ceratotoxin-1 (75%), Ceratotoxin-2 (#STC-100) (77%) and Pterinotoxin-1 (#STT-100) (83%).

Supplier :

Alomone Labs

Target :

NaV1.3, NaV1.7, NaV1.8 Na+ channels

Long Description :

A Blocker of NaV1.3, NaV1.7, NaV1.8 Voltage-Gated Na+ Channels

Short Description :

A Blocker of NaV1.3, NaV1.7, NaV1.8 Voltage-Gated Na+ Channels

MW :

4171.8 Da

Synonyms :

κ-Theraphotoxin-Gr4a, Kappa-TRTX-Gr4a, Voltage sensor toxin 3, Peptide F

Modifications :

Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29

Molecular formula :

C182H261N51O51S6

Effective Concentration :

200 - 500 nM

Activity :

VSTX3 inhibits voltage-gated Na+ channels NaV1.3, NaV1.7 and NaV1.81.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

DCLGWFKGCDPDNDKCCEGYKCNRRDKWCKYKLW-OH

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage