GTx1-15 | Alomone Labs STT-300 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

GTx1-15

catalog :

STT-300

more info or order :

Alomone Labs product webpage

citations: 2

Reference
Yin X, Jie H, Liang M, Gong L, Liu H, Pan H, et al. Accelerated Development of the First-Order Central Auditory Neurons With Spontaneous Activity. Front Mol Neurosci. 2018;11:183 pubmed publisher
Kikuchi K, Sugiura M, Kimura T. High Proteolytic Resistance of Spider-Derived Inhibitor Cystine Knots. Int J Pept. 2015;2015:537508 pubmed publisher

image

image 1 :

image 2 :

Alomone Labs GTx1-15 inhibits rat NaV1.3 channels heterologously expressed in HEK-293 cells. - A. Dose-response of NaV1.3 channel inhibition byGTx1-15(#STT-300). The inhibition was measured in 3-5 cells for each dose. B. Example of superimposed current traces of rat NaV1.3 channel activity before and during application of 0.3 M of GTx1-15. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 40 msec from holding potential to +60 mV.

product information

cat :

STT-300

SKU :

STT-300_0.1 mg

Product Name :

GTx1-15

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

P0DJA9

Accession Number :

https://www.uniprot.org/uniprotkb/P0DJA9/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Grammostola rosea (Chilean rose tarantula) (Phrixotrichus auratus)(Grammostola spatulata)

Source :

Synthetic peptide

Gene ID :

CACNA1G,SCN10A,SCN1A,SCN2A,SCN3A,SCN4A,SCN5A,SCN8A,SCN9A

Product Page - Scientific background :

GTx1-15 is isolated from the Grammostola rosea (Phrixotrichus auratus) spider venom and is a synthetic version of the peptide1,2.GTx1-15 inhibits voltage-gated rat NaV1.3 and NaV1.7 Na+ channels, as well as T-type Ca2+ channels1,2.Voltage-gated Na+ channels (VGSC, NaV) play a critical role in excitability of nociceptors (pain-sensing neurons).The peripheral-specific Na+ channels NaV1.7, NaV1.8 and NaV1.9 are particularly important in the pathophysiology of different pain syndromes and hence, thought to be potential targets for pain therapeutics3-4. The expression and functional properties of NaV channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation5.GTx1-15 shows high homology to Phrixotoxin-3 (#STP-720) (76%) and Ceratotoxin-2 (#STC-100) (57%).

Supplier :

Alomone Labs

Target :

NaV Na+ Channels, T-type Ca2+ channels

Long Description :

A Blocker of Voltage-Gated Na+ and T-Type Ca2+ Channels

Short Description :

A Blocker of Voltage-Gated Na+ and T-Type Ca2+ Channels

MW :

4073.8 Da

Synonyms :

ω/β-Theraphotoxin-Ps2a, β-TRTX-Ps2a, Peptide E, β/ω-TRTX-Gr2a

Modifications :

Disulfide bonds between: Cys2-Cys17, Cys9-Cys23, Cys16-Cys30 Phe34 - C-terminal amidation

Molecular formula :

C176H271N53O45S7

Effective Concentration :

200 - 500 nM

Activity :

GTx1-15 inhibits rat NaV1.3 and NaV1.7 voltage-gated Na+ channels as well as T-type Ca2+ channels.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

DCLGFMRKCIPDNDKCCRPNLVCSRTHKWCKYVF-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage