Haplotoxin-2 | Alomone Labs STT-200 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Haplotoxin-2

catalog :

STT-200

more info or order :

Alomone Labs product webpage

image

image 1 :

Alomone LabsMemantine hydrochlorideinhibits NMDA (NR1+NR2A) channels expressed inXenopusoocytes. - A. Time course of NMDA currents elicited 100 M glutamate every 50s while membrane potential was held at -80 mV. 1 and 10 MMemantine hydrochloride(#M-145) applied for 2 min each as indicated reversibly inhibited current amplitude. B. superimposed current traces taken from the experiment described in A.

image 2 :

Alomone Labs Haplotoxin-2inhibits rNaV1.3 andhERG channels heterologously expressed in HEK293 cells. - A. Dose-response of NaVand KVchannels inhibition byHaplotoxin-2(#STT-200). The inhibition was measured in 3-5 cells for each dose in rat NaV1.3 channels expressed in HEK293 cells (open circles) and 3-5 cells for human KV11.1 (hERG) expressed in HEK293 cells (open triangles). B. Example of superimposed current traces of rat NaV1.3 channel activity before and during application of 0.15 M of Haplotoxin-2. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 40 msec from holding potential to +60 mV.

product information

cat :

STT-200

SKU :

STT-200_0.1 mg

Product Name :

Haplotoxin-2

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

B3EWN3

Accession Number :

https://www.uniprot.org/uniprotkb/B3EWN3/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Cyriopagopus lividus (Cobalt blue tarantula) (Haplopelma lividum)

Source :

Synthetic peptide

Gene ID :

KCNH2,SCN3A

Product Page - Scientific background :

Haplotoxin-2 is isolated from the Haplopelma Lividum spider venom and is a synthetic version of the peptide1.Haplotoxin-2 inhibits voltage-gated rat NaV1.3 Na+ channels.Voltage-gated sodium channels (VGSC, NaV) play a critical role in excitability of nociceptors (pain-sensing neurons). The peripheral-specific sodium channels NaV1.7, NaV1.8 and NaV1.9 are particularly important in the pathophysiology of different pain syndromes and hence, thought to be potential targets for pain therapeutics2-3.The expression and functional properties of NaV channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation4.Haplotoxin-2 shows high homology to Huwentoxin-I (78%), Hainantoxin-III (#STH-120) (76%) and Phrixotoxin-3 (#STP-720) (65%).

Supplier :

Alomone Labs

Target :

NaV1.3 Na+ channels, KV11.1 K+ channels

Long Description :

A Blocker of NaV1.3 Na+ Channel and HERG K+ Channel

Short Description :

A Blocker of NaV1.3 Na+ Channel and HERG K+ Channel

MW :

3708.4 Da

Synonyms :

Beta/kappa-theraphotoxin-Hlv1a, Beta/kappa-TRTX-Hlv1a, Beta/kappa-theraphotoxin-Hl2a, Beta/kappa-TRTX-Hl2a

Modifications :

Disulfide bonds between: Cys2-Cys17, Cys9-Cys22, Cys16-Cys29 IIe33 - C-terminal amidation

Molecular formula :

C161H248N46O43S6

Effective Concentration :

100 - 500 nM

Activity :

Haplotoxin-2 inhibits voltage-gated Na+ channels NaV1.3 as well as KV11.1 (hERG) channels1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

ACKGLFVTCTPGKDECCPNHVCSSKHKWCKYKI-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage