Pterinotoxin-2 | Alomone Labs STT-150 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Pterinotoxin-2

catalog :

STT-150

more info or order :

Alomone Labs product webpage

image

image 1 :

Alomone LabsPU02blocks 5-HT3A receptors expressed in HEK 293T cells. - 5-HT3A receptor currents were elicited by 10 M 5-HT delivered every 3 minutes.PU02(#P-165) was applied 30 seconds before stimulation at 0.1 1 and 10 M as indicated and inhibited the 5-HT induced current in a dose dependent and reversible manner.

image 2 :

Alomone Labs Pterinotoxin-2inhibits rNav1.3 and hNaV1.7 channels heterologously expressed in HEK293 cells. - A. Dose-response of NaVchannels inhibition byPterinotoxin-2(#STT-150). The inhibition was measured in 3-5 cells for each dose in rat Nav1.3 channels expressed in HEK cells (open circles) and 3-5 cells for human NaV1.7 expressed in HEK cells (filled circles). B. Example of superimposed current traces of rat NaV1.3 channel activity before (black) and during (green) application of the indicated concentration of 0.5 M Pterinotoxin-2. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 40 msec from holding potential to +60 mV.

product information

cat :

STT-150

SKU :

STT-150_0.1 mg

Product Name :

Pterinotoxin-2

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

B3EWN1

Accession Number :

https://www.uniprot.org/uniprotkb/B3EWN1/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Pterinochilus murinus (Mombasa golden starburst baboon spider)

Source :

Synthetic peptide

Gene ID :

SCN3A,SCN9A

Product Page - Scientific background :

Pterinotoxin-2 is isolated from the Pterinochilus murinus (Usambara) spider venom and is a synthetic version of the peptide1.Pterinotoxin-2 inhibits voltage-gated rat NaV1.3 and NaV1.7 Na+ channels.Voltage-gated sodium channels (VGSC, NaV) play a critical role in excitability of nociceptors (pain-sensing neurons). The peripheral-specific sodium channels NaV1.7, NaV1.8 and NaV1.9 are particularly important in the pathophysiology of different pain syndromes and hence, thought to be potential targets for pain therapeutics2,3.The expression and functional properties of NaV channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation4.Pterinotoxin-2 shows high homology to ProTx-II (#STP-100) (75%), Phrixotoxin-2 (#STP-710) (76%) and Phrixotoxin-1 (#STP-700) (70%).

Supplier :

Alomone Labs

Target :

NaV1.3, NaV1.7 Na+ channels

Long Description :

A Blocker of NaV1.3 and NaV1.7 Na+ Channels

Short Description :

A Blocker of NaV1.3 and NaV1.7 Na+ Channels

MW :

3639.3 Da

Synonyms :

β/κ-Theraphotoxin-Pm2a, β/κ-TRTX-Pm2a, Beta/kappa-theraphotoxin-Pmu2a

Modifications :

Disulfide bonds between: Cys2-Cys16, Cys9-Cys21, Cys15-Cys25 Leu29 - C-terminal amidation

Molecular formula :

C156H237N45O42S7

Effective Concentration :

0.5 - 1 µM

Activity :

Pterinotoxin-2 inhibits voltage-gated Na+ NaV1.3 and NaV1.7 channels1.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

YCQEFLWTCDEERKCCGDMVCRLWCKKRL-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage