product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
Pterinotoxin-1
catalog :
STT-100
more info or order :
image
image 1 :

Alomone Labs Pterinotoxin-1 inhibits rat NaV1.3 and NaV1.8 channels heterologously expressed in HEK and ND7-23 cells respectively. - A. Dose response of NaVchannels inhibition byPterinotoxin-1(#STT-100). The inhibition was measured in 3-5 cells for each dose in rat NaV1.3 channels expressed in HEK cells and 3-5 cells for rat NaV1.8 expressed in ND7-23 cells (in the presence of 600 nMTetrodotoxincitrate(#T-550)). B. Example of superimposed current traces of rat NaV1.3 channel activity before and during application of 2 M of Pterinotoxin-1. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 40 msec from holding potential to + 60 mV. C. Example of superimposed current traces of rat NaV1.8 channel activity before and during application of 2 M of Pterinotoxin-1 (both in the presence of 600 nM Tetrodotoxin(with citrate)). The same voltage protocol was used as in graph B.
product information
cat :
STT-100
SKU :
STT-100_0.1 mg
Product Name :
Pterinotoxin-1
Group Type :
Non Antibodies
Product Type :
Proteins
Accession :
B3EWN0
Accession Number :
https://www.uniprot.org/uniprotkb/B3EWN0/entry
Applications :
Electrophysiology
Formulation :
Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Pterinochilus murinus (Mombasa golden starburst baboon spider)
Source :
Synthetic peptide
Gene ID :
SCN10A,SCN3A,SCN9A
Product Page - Scientific background :
Pterinotoxin-1 is isolated from the Pterinochilus murinus (Usambara) spider venom and is a synthetic version of the peptide1.Pterinotoxin-1 inhibits voltage-gated rat NaV1.3, NaV1.7 and NaV1.8 Na+ channels.Voltage-gated Na+ channels (VGSC, NaV) play a critical role in excitability of nociceptors (pain-sensing neurons). The peripheral-specific Na+ channels NaV1.7, NaV1.8 and NaV1.9 are particularly important in the pathophysiology of different pain syndromes and, hence, thought to be potential targets for pain therapeutics2-3.The expression and functional properties of NaV channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation4.Pterinotoxin-1 shows high homology to Phrixotoxin-3 (#STP-720) (58%), Huwentoxin-IV (#STH-100) (50%) and Ceratotoxin-2 (#STC-100) (66%).
Supplier :
Alomone Labs
Target :
NaV channels
Long Description :
A Novel Blocker of NaV1.3, NaV1.7, and NaV1.8 Voltage-Gated Na+ Channels
Short Description :
A Novel Blocker of NaV1.3, NaV1.7, and NaV1.8 Voltage-Gated Na+ Channels
MW :
3969.5 Da
Synonyms :
β-Theraphotoxin-Pm1a, β-TRTX-Pm1a, Beta-theraphotoxin-Pmu1a
Modifications :
Disulfide bonds between: Cys3-Cys18, Cys10-Cys23, Cys17-Cys30 Leu34 - C-terminal amidation
Molecular formula :
C163H251N49O53S7
Effective Concentration :
2 - 5 µM
Activity :
Pterinotoxin-1 inhibits rat voltage-gated Na+ channels NaV1.3, NaV1.7 and NaV1.8.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
DDCLGMFSSCDPDNDKCCEGRKCNRKDKWCKYVL-NH2
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information

Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com972 2 531 8002
headquarters: Israel
browse more products
questions and comments
