Pterinotoxin-1 | Alomone Labs STT-100 product information

product summary

company name :

Alomone Labs

product type :

chemical

product name :

Pterinotoxin-1

catalog :

STT-100

more info or order :

Alomone Labs product webpage

image

image 1 :

Alomone Labs Pterinotoxin-1 inhibits rat NaV1.3 and NaV1.8 channels heterologously expressed in HEK and ND7-23 cells respectively. - A. Dose response of NaVchannels inhibition byPterinotoxin-1(#STT-100). The inhibition was measured in 3-5 cells for each dose in rat NaV1.3 channels expressed in HEK cells and 3-5 cells for rat NaV1.8 expressed in ND7-23 cells (in the presence of 600 nMTetrodotoxincitrate(#T-550)). B. Example of superimposed current traces of rat NaV1.3 channel activity before and during application of 2 M of Pterinotoxin-1. Holding potential was -100 mV and currents were stimulated every 10 seconds by a voltage ramp of 40 msec from holding potential to + 60 mV. C. Example of superimposed current traces of rat NaV1.8 channel activity before and during application of 2 M of Pterinotoxin-1 (both in the presence of 600 nM Tetrodotoxin(with citrate)). The same voltage protocol was used as in graph B.

product information

cat :

STT-100

SKU :

STT-100_0.1 mg

Product Name :

Pterinotoxin-1

Group Type :

Non Antibodies

Product Type :

Proteins

Accession :

B3EWN0

Accession Number :

https://www.uniprot.org/uniprotkb/B3EWN0/entry

Applications :

Electrophysiology

Formulation :

Lyophilized from filtrated Ammonium acetate solution. May contain acetate as a residual counter ion.

Storage After Reconstitution :

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Reconstitution and Solubility :

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Solubility :

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Storage Before Reconstitution :

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Origin :

Pterinochilus murinus (Mombasa golden starburst baboon spider)

Source :

Synthetic peptide

Gene ID :

SCN10A,SCN3A,SCN9A

Product Page - Scientific background :

Pterinotoxin-1 is isolated from the Pterinochilus murinus (Usambara) spider venom and is a synthetic version of the peptide1.Pterinotoxin-1 inhibits voltage-gated rat NaV1.3, NaV1.7 and NaV1.8 Na+ channels.Voltage-gated Na+ channels (VGSC, NaV) play a critical role in excitability of nociceptors (pain-sensing neurons). The peripheral-specific Na+ channels NaV1.7, NaV1.8 and NaV1.9 are particularly important in the pathophysiology of different pain syndromes and, hence, thought to be potential targets for pain therapeutics2-3.The expression and functional properties of NaV channels in peripheral sensory neurons can be dynamically regulated following axonal injury or peripheral inflammation4.Pterinotoxin-1 shows high homology to Phrixotoxin-3 (#STP-720) (58%), Huwentoxin-IV (#STH-100) (50%) and Ceratotoxin-2 (#STC-100) (66%).

Supplier :

Alomone Labs

Target :

NaV channels

Long Description :

A Novel Blocker of NaV1.3, NaV1.7, and NaV1.8 Voltage-Gated Na+ Channels

Short Description :

A Novel Blocker of NaV1.3, NaV1.7, and NaV1.8 Voltage-Gated Na+ Channels

MW :

3969.5 Da

Synonyms :

β-Theraphotoxin-Pm1a, β-TRTX-Pm1a, Beta-theraphotoxin-Pmu1a

Modifications :

Disulfide bonds between: Cys3-Cys18, Cys10-Cys23, Cys17-Cys30 Leu34 - C-terminal amidation

Molecular formula :

C163H251N49O53S7

Effective Concentration :

2 - 5 µM

Activity :

Pterinotoxin-1 inhibits rat voltage-gated Na+ channels NaV1.3, NaV1.7 and NaV1.8.

Storage of solutions :

Lead Time :

1-2 Business Days

Country of origin :

Israel/IL

Purity :

≥98% (HPLC)

Form :

Lyophilized

Comment :

Contact Alomone Labs for technical support and product customization

Sequence :

DDCLGMFSSCDPDNDKCCEGRKCNRKDKWCKYVL-NH2

Is Toxin :

Yes

UNSPSC :

12352202

Bioassay Tested :

yes

Steril endotoxin free :

more info or order :

Alomone Labs product webpage