chemical

Tf2 Toxin

STT-050

STT-050_0.1 mg

Tf2 Toxin

Non Antibodies

Proteins

C0HJM9

https://www.uniprot.org/uniprotkb/C0HJM9/entry

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Tityus fasciolatus (Central Brazilian scorpion)

Synthetic protein

SCN11A,SCN3A

Tf2 Toxin is a β-scorpion peptide toxin originally isolated from the venom of the Brazilian scorpion Tityus fasciolatus. Tf2 Toxin acts as a NaV1.3 channel opener. It shifts human NaV1.3 channel voltage activation towards negative values and effectively opens the channel at resting membrane potentials1. The toxin was also found to open NaV1.9 channels4.NaV channels are integral membrane proteins that allow movement of Na+ ions across cellular membranes. in response to local membrane depolarization these channels mediate the influx of Na+ ions2,3.NaV1.3 channel is encoded by the Scn3A gene and is expressed in peripheral nociceptive neurons of dorsal root ganglion, in the developing nervous system and in pancreatic islet cells2. Abnormalities in Scn3A gene expression are associated with epilepsy, mental retardation, autism, and neuropathic pain3.

Alomone Labs

NaV1.3, NaV1.9 channels

An Opener of NaV1.3 and NaV1.9 Channels

An Opener of NaV1.3 and NaV1.9 Channels

6954 Da

Tf2 scorpion toxin

Disulfide bonds between: Cys11-Cys62, Cys15-Cys38, Cys23-Cys43, Cys27-Cys45 Cys62 - C-terminal amidation

C309H438N80O87S9

1 µM

Tf2 Toxin is a NaV1.3 and NaV1.9 channel opener1,2.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCA
WPACYCYGVPSNIKVWDYATNKC-NH2

Yes

12352202

yes

no