product summary
Loading...
company name :
Alomone Labs
product type :
chemical
product name :
SpTx-1
catalog :
STS-800
more info or order :
product information
cat :
STS-800
SKU :
STS-800_0.1 mg
Product Name :
SpTx-1
Group Type :
Non Antibodies
Product Type :
Proteins
Applications :
Electrophysiology
Formulation :
Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.
Storage After Reconstitution :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Reconstitution and Solubility :
Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Solubility :
Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.
Storage Before Reconstitution :
The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.
Origin :
Scolopendra polymorpha.
Source :
Synthetic peptide
Gene ID :
KCNJ11,ABCC8
Product Page - Scientific background :
SpTx-1 is a 54 amino acid peptidyl toxin originally isolated from the venom of the centipede, Scolopendra polymorpha. This toxin blocks the adenosine triphosphate (ATP)-sensitive K+ (KATP) channel with a Kd value of 15 nM, primarily by targeting of the pore-forming inwardly rectifying K+ channel (Kir) 6.2 subunit that is coexpressed with the regulatory sulfonylurea receptor 1 (SUR1)1.The KATP channel is a hetero-octameric protein complex, consisting of four Kir6.x pore subunits and four regulatory ATP-binding cassette SURx subunits. The KATP channels are present in many different tissues such as skeletal muscle, smooth muscle, pancreatic β-cells, cardiomyocytes, and brain. Since these channels are responsible for linking cell metabolism and membrane potential, they are crucial for the regulation of different cellular pathways2. Kir6.x or SUR mutations result in KATP channelopathies, which reflect the physiological roles of these channels, including but not limited to insulin secretion, cardiac protection, neuroprotection, and blood flow regulation3,4.
Supplier :
Alomone Labs
Target :
hKATP inhibitor, Kir6.2
Long Description :
A human KATP (Kir6.2/SUR1) potassium channel blocker
Short Description :
A human KATP (Kir6.2/SUR1) potassium channel blocker
MW :
6366.4 Da
Synonyms :
SpTx1
Modifications :
Disulfide bonds between: The exact location of the disulfide bridges is currently unknown.
Molecular formula :
C286H441N77O80S4
Effective Concentration :
15 - 50 nM
Activity :
SpTx-1 inhibits hKATP channels with a Kd of 15 nM by blocking the hKir6.2 pore1.
Storage of solutions :
The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.
Lead Time :
1-2 Business Days
Country of origin :
Israel/IL
Purity :
≥98% (HPLC)
Form :
Lyophilized
Comment :
Contact Alomone Labs for technical support and product customization
Sequence :
ADLIKKKLPFRTRSKFPRKSECVQDCAKAFTNGNKDKIK
DVKSEFFSCYCWYEA-OH
Is Toxin :
Yes
UNSPSC :
12352202
Bioassay Tested :
yes
Steril endotoxin free :
no
more info or order :
company information
Alomone Labs
Jerusalem BioPark (JBP), Hadassah Ein Kerem
P.O. Box 4287
Jerusalem 9104201
info@alomone.com
http://www.alomone.com
972 2 531 8002
headquarters: Israel