chemical

SpTx-1

STS-800

STS-800_0.1 mg

SpTx-1

Non Antibodies

Proteins

Electrophysiology

Lyophilized from double distilled water (ddH2O). May contain TFA as a residual counter ion.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

Centrifuge the vial (10,000 × g for 5 minutes) before adding solvent to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Gently tap, tilt, and roll the vial to aid dissolution. Avoid vigorous vortexing; light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

Centrifuge the vial before adding solvent (10,000 x g for 5 minutes) to spin down all the powder to the bottom of the vial. The lyophilized product may be difficult to visualize. Add solvent directly to the centrifuged vial. Tap the vial to aid in dissolving the lyophilized product. Tilt and gently roll the liquid over the walls of the vial. Avoid vigorous vortexing. Light vortexing for up to 3 seconds is acceptable if needed. The product is soluble in pure water at high micromolar concentrations (100 µM - 1 mM). For long-term storage in solution, we recommend preparing a stock solution by dissolving the product in double-distilled water (ddH2O) at a concentration between 100-1000x of the final working concentration. Divide the stock solution into small aliquots and store at -20°C. Before use, thaw the relevant vial(s) and dilute to the desired working concentration in your working buffer. Centrifuge all product preparations before use. It is recommended to prepare fresh solutions in working buffers just before use. Avoid multiple freeze-thaw cycles to maintain biological activity.

The product is shipped as a lyophilized powder at room temperature. Upon receipt, store the product at -20°C. Protect from moisture.

Scolopendra polymorpha.

Synthetic peptide

KCNJ11,ABCC8

SpTx-1 is a 54 amino acid peptidyl toxin originally isolated from the venom of the centipede, Scolopendra polymorpha. This toxin blocks the adenosine triphosphate (ATP)-sensitive K+ (KATP) channel with a Kd value of 15 nM, primarily by targeting of the pore-forming inwardly rectifying K+ channel (Kir) 6.2 subunit that is coexpressed with the regulatory sulfonylurea receptor 1 (SUR1)1.The KATP channel is a hetero-octameric protein complex, consisting of four Kir6.x pore subunits and four regulatory ATP-binding cassette SURx subunits. The KATP channels are present in many different tissues such as skeletal muscle, smooth muscle, pancreatic β-cells, cardiomyocytes, and brain. Since these channels are responsible for linking cell metabolism and membrane potential, they are crucial for the regulation of different cellular pathways2. Kir6.x or SUR mutations result in KATP channelopathies, which reflect the physiological roles of these channels, including but not limited to insulin secretion, cardiac protection, neuroprotection, and blood flow regulation3,4.

Alomone Labs

hKATP inhibitor, Kir6.2

A human KATP (Kir6.2/SUR1) potassium channel blocker

A human KATP (Kir6.2/SUR1) potassium channel blocker

6366.4 Da

SpTx1

Disulfide bonds between: The exact location of the disulfide bridges is currently unknown.

C286H441N77O80S4

15 - 50 nM

SpTx-1 inhibits hKATP channels with a Kd of 15 nM by blocking the hKir6.2 pore1.

The reconstituted solution can be stored at 4°C for up to 1 week. For longer periods (up to 6 months), small aliquots should be stored at -20°C. We do not recommend storing the product in working solutions for longer than a few days. Avoid multiple freeze-thaw cycles.

1-2 Business Days

Israel/IL

≥98% (HPLC)

Lyophilized

Contact Alomone Labs for technical support and product customization

ADLIKKKLPFRTRSKFPRKSECVQDCAKAFTNGNKDKIK
DVKSEFFSCYCWYEA-OH

Yes

12352202

yes

no